KEGG   Macaca mulatta (rhesus monkey): 106992322
Entry
106992322         CDS       T01028                                 

Definition
(RefSeq) interferon alpha-17
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106992322
   04151 PI3K-Akt signaling pathway
    106992322
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106992322
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106992322
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106992322
   04621 NOD-like receptor signaling pathway
    106992322
   04622 RIG-I-like receptor signaling pathway
    106992322
   04623 Cytosolic DNA-sensing pathway
    106992322
   04650 Natural killer cell mediated cytotoxicity
    106992322
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106992322
  09163 Immune disease
   05320 Autoimmune thyroid disease
    106992322
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    106992322
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106992322
   05161 Hepatitis B
    106992322
   05160 Hepatitis C
    106992322
   05171 Coronavirus disease - COVID-19
    106992322
   05164 Influenza A
    106992322
   05162 Measles
    106992322
   05168 Herpes simplex virus 1 infection
    106992322
   05163 Human cytomegalovirus infection
    106992322
   05167 Kaposi sarcoma-associated herpesvirus infection
    106992322
   05169 Epstein-Barr virus infection
    106992322
   05165 Human papillomavirus infection
    106992322
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    106992322
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   106992322
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 106992322
NCBI-ProteinID: XP_014985020
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAVVVLSYKSICSLGCDLPQIHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSAELYQQLNDLK
ACVIAEPGMEDTPLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRTEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggctgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgcctcagatccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaaggatctctccgttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatgtctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaacctcctagaaaaattttccgctgagctttaccagcaactgaatgacctgaaa
gcctgtgtgatagcagagcctgggatggaagacactcccttgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaaatacagc
ccatgtgcctgggaggttgtcagaacagaaatcatgagatctctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 106993736
Entry
106993736         CDS       T01028                                 

Gene name
IFNE
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04622  RIG-I-like receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106993736 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106993736 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    106993736 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    106993736 (IFNE)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   106993736 (IFNE)
SSDB
Motif
Pfam: Interferon DUF1027
Other DBs
NCBI-GeneID: 106993736
NCBI-ProteinID: XP_014973103
Ensembl: ENSMMUG00000046871
LinkDB
Position
15
AA seq 193 aa
MIIKHFFEIMLVLLASTTVFFLDLKLILFQQKRVNQESLKLLNKLQTSSIHLCLPHRKNF
LLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHMEKFLIQLHQQLEYL
EALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSSCAWAIVQVEINRCLFFVF
SLTEKLSKQGTDP
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattatcaagcacttctttgaaattatgttggtgctgctggcctctaccactgtcttc
tttctagatttgaaactgattctcttccagcaaaaaagagtgaatcaagaaagtttaaaa
ctcttgaataagttgcaaacctcatcaattcacctatgtctaccacacaggaaaaacttt
ctgcttcctcagaagtctttgagtcctcagcagtaccaaaaaggacatactctggccatt
ctccatgagatgcttcagcagatcttcagcctcttcagggcaaatatttctctggatggt
tgggaggaaaatcacatggagaaattcctaattcaacttcatcaacagctagaataccta
gaagcactcatgggactggaagcagagaagctaagtggtactttgggtagtgataacctt
agattacaagttaaaatgtacttccgaaggatccatgattacctggaaaaccaggactac
agcagctgtgcctgggccattgtccaagtagaaatcaaccgatgtcttttctttgtgttc
agtctcacagaaaagctgagcaaacaaggaacagacccttga

KEGG   Macaca mulatta (rhesus monkey): 106995851
Entry
106995851         CDS       T01028                                 

Gene name
IFNA6
Definition
(RefSeq) interferon alpha-6
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106995851 (IFNA6)
   04151 PI3K-Akt signaling pathway
    106995851 (IFNA6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106995851 (IFNA6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106995851 (IFNA6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106995851 (IFNA6)
   04621 NOD-like receptor signaling pathway
    106995851 (IFNA6)
   04622 RIG-I-like receptor signaling pathway
    106995851 (IFNA6)
   04623 Cytosolic DNA-sensing pathway
    106995851 (IFNA6)
   04650 Natural killer cell mediated cytotoxicity
    106995851 (IFNA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106995851 (IFNA6)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    106995851 (IFNA6)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    106995851 (IFNA6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106995851 (IFNA6)
   05161 Hepatitis B
    106995851 (IFNA6)
   05160 Hepatitis C
    106995851 (IFNA6)
   05171 Coronavirus disease - COVID-19
    106995851 (IFNA6)
   05164 Influenza A
    106995851 (IFNA6)
   05162 Measles
    106995851 (IFNA6)
   05168 Herpes simplex virus 1 infection
    106995851 (IFNA6)
   05163 Human cytomegalovirus infection
    106995851 (IFNA6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106995851 (IFNA6)
   05169 Epstein-Barr virus infection
    106995851 (IFNA6)
   05165 Human papillomavirus infection
    106995851 (IFNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    106995851 (IFNA6)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   106995851 (IFNA6)
SSDB
Motif
Pfam: Interferon DDHD
Other DBs
NCBI-GeneID: 106995851
NCBI-ProteinID: XP_014984511
LinkDB
Position
15
AA seq 189 aa
MALPFALLMALVVLSCKSSCSLGCDLPQTHSLGHRRTMMLLVQMRRISLFSCLKDRHDFR
FPQEEFDGNQFQKAQAISVLHEVIQQTYNLFSTKDSSAAWDEMLLDKLYTELYQQLNDLE
ACVMQEAWVGETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgccttttgctttactgatggccctggtggtgctcagctgcaagtcaagttgc
tctctgggctgtgatctgcctcagacccacagcctgggtcacaggaggaccatgatgctc
ctggtacaaatgagaagaatctctcttttctcctgtctgaaggacagacacgacttcaga
tttccccaggaggagtttgatggcaaccagttccagaaggctcaagctatctctgtcctc
catgaggtgatccagcagacctacaacctcttcagcacaaaggactcatctgctgcttgg
gatgaaatgcttctagacaaactctacactgaactttaccagcagctgaatgacctggaa
gcctgtgtgatgcaggaggcgtgggtgggagagactcccctgatgaatgaggactccatc
ctggctgtgagaaaatacttccaaagaatcactctctacctgacagagaagaagtatagc
ccttgtgcatgggaggttgtcagagcagaaatcatgagatccttctcttcatcaagaaac
ttgcaagaaagattaaggaggaaggaataa

KEGG   Macaca mulatta (rhesus monkey): 114672663
Entry
114672663         CDS       T01028                                 

Definition
(RefSeq) interferon alpha-17-like
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114672663
   04151 PI3K-Akt signaling pathway
    114672663
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114672663
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    114672663
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114672663
   04621 NOD-like receptor signaling pathway
    114672663
   04622 RIG-I-like receptor signaling pathway
    114672663
   04623 Cytosolic DNA-sensing pathway
    114672663
   04650 Natural killer cell mediated cytotoxicity
    114672663
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114672663
  09163 Immune disease
   05320 Autoimmune thyroid disease
    114672663
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    114672663
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    114672663
   05161 Hepatitis B
    114672663
   05160 Hepatitis C
    114672663
   05171 Coronavirus disease - COVID-19
    114672663
   05164 Influenza A
    114672663
   05162 Measles
    114672663
   05168 Herpes simplex virus 1 infection
    114672663
   05163 Human cytomegalovirus infection
    114672663
   05167 Kaposi sarcoma-associated herpesvirus infection
    114672663
   05169 Epstein-Barr virus infection
    114672663
   05165 Human papillomavirus infection
    114672663
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    114672663
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   114672663
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 114672663
NCBI-ProteinID: XP_028690318
LinkDB
Position
15
AA seq 189 aa
MALSFPLLVAVVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMERISPFSCLKDRRDFG
FPQEEFDGNQFQKAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSAELYQQLNDLK
ACVIAEPGMEETLLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRTEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtcctttcctttactggtggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatcttcctcagacccacagcctgggtcataggagggccttgatactc
ctggcacaaatggaaagaatctctcctttctcctgtctgaaggacagacgtgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatgtctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaacctcctagaaaaattttccgctgagctttaccagcaactgaatgacctgaaa
gcctgtgtgatagcagagcctgggatggaagagactctcttgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaaatacagc
ccttgtgcctgggaggttgtcagaacagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaaggttaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 114672664
Entry
114672664         CDS       T01028                                 

Definition
(RefSeq) interferon alpha-17-like
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114672664
   04151 PI3K-Akt signaling pathway
    114672664
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114672664
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    114672664
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114672664
   04621 NOD-like receptor signaling pathway
    114672664
   04622 RIG-I-like receptor signaling pathway
    114672664
   04623 Cytosolic DNA-sensing pathway
    114672664
   04650 Natural killer cell mediated cytotoxicity
    114672664
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114672664
  09163 Immune disease
   05320 Autoimmune thyroid disease
    114672664
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    114672664
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    114672664
   05161 Hepatitis B
    114672664
   05160 Hepatitis C
    114672664
   05171 Coronavirus disease - COVID-19
    114672664
   05164 Influenza A
    114672664
   05162 Measles
    114672664
   05168 Herpes simplex virus 1 infection
    114672664
   05163 Human cytomegalovirus infection
    114672664
   05167 Kaposi sarcoma-associated herpesvirus infection
    114672664
   05169 Epstein-Barr virus infection
    114672664
   05165 Human papillomavirus infection
    114672664
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    114672664
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   114672664
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 114672664
NCBI-ProteinID: XP_028690320
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAVVVLSYKSICSLGCDPPRTHSLGHRRSLILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSAELYQQLNALE
ACVIAEPGMEETLLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQRKLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatcctccccggacccacagcctgggtcataggaggtccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatgtctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaacctcctagaaaaattttccgctgagctttaccagcaactgaatgccttggaa
gcctgtgtgatagcagagcctgggatggaagagactctcttgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaagtacagc
ccctgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaagaaaattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 114675730
Entry
114675730         CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon omega-1-like
  KO
K05440  interferon omega
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04622  RIG-I-like receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114675730
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114675730
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    114675730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    114675730
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   114675730
SSDB
Motif
Pfam: Interferon CDT1_C
Other DBs
NCBI-GeneID: 114675730
NCBI-ProteinID: XP_028698706
LinkDB
Position
Unknown
AA seq 195 aa
MALLFPLLAALVMTSYSPVGSXGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFR
FPQEMVEGSQLQKAQVMSVLHEMLQQIFSLFHTERSSAAWNTTLLDHLHTGLHRQLEHLE
TCLVQVMREGESAGAIRSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTN
MQERLRSKDGDLGSS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccctcctcttccctctgctggcagccctagtgatgaccagctatagtcctgttgga
tctnctggctgtgatctgcctcagaaccatggcctacttagcaggaacaccttggtgctt
ctgcaccaaatgaggagaatctcccctttcttgtgtctcaaggacagaagagacttcagg
ttcccccaggagatggtagaagggagccagctgcagaaggcccaggtcatgtctgtcctc
catgagatgctacagcagatcttcagcctcttccacacagagcgctcctctgctgcctgg
aacacgaccctcctagaccatctccacactggacttcatcggcaactagaacacctggag
acctgcttggtgcaggtaatgcgagaaggagaatctgctggggcgattaggagccctgca
ctgaccttgaggaggtacttccagggaatccgtgtctacctgaaagagaagaaatacagc
gactgtgcctgggaagttgtcagaatggaaatcatgaaatccttgttcttatcaacaaac
atgcaagaaagactgagaagtaaagatggagacctggggtcatcttga

KEGG   Macaca mulatta (rhesus monkey): 574168
Entry
574168            CDS       T01028                                 

Gene name
IL7
Definition
(RefSeq) interleukin-7 precursor
  KO
K05431  interleukin 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    574168 (IL7)
   04151 PI3K-Akt signaling pathway
    574168 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574168 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    574168 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574168 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    574168 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    574168 (IL7)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   574168 (IL7)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Cytokines
   574168 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 574168
NCBI-ProteinID: NP_001028018
Ensembl: ENSMMUG00000001655
UniProt: Q95J83
LinkDB
Position
8
AA seq 177 aa
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCL
NNEFNFFKRHLCDDNKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGK
VKGRKPAALGEPQPTKSLEENKSLKEQKKLNDSCFLKRLLQKIKTCWNKILMGTKEH
NT seq 534 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggacttcctcccctgatccttgttctgttg
ccagtagcatcatctgattgtgatattgaaggtaaagatggcaaacaatatgagagtgtt
ctaatggtcagcatcgatcaattattggacagcatgaaagaaattggtagcaattgcctg
aataatgaatttaacttttttaaaagacatctatgtgatgataataaggaaggtatgttt
ttattccgtgctgctcgcaagttgaggcaatttcttaaaatgaatagcactggtgatttt
gatctccacttattaaaagtttcagaaggcacaacaatactgttgaactgcaccggcaag
gttaaaggaagaaaaccagctgccctgggtgaaccccaaccaacaaagagtttggaagaa
aataaatctttaaaggaacagaaaaaactgaatgactcatgtttcctaaagagactacta
caaaagataaaaacttgttggaataaaattttgatgggcactaaagaacactga

KEGG   Macaca mulatta (rhesus monkey): 574281
Entry
574281            CDS       T01028                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 precursor
  KO
K05430  interleukin 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc05140  Leishmaniasis
mcc05200  Pathways in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05321  Inflammatory bowel disease
mcc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    574281 (IL4)
   04151 PI3K-Akt signaling pathway
    574281 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574281 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    574281 (IL4)
   04660 T cell receptor signaling pathway
    574281 (IL4)
   04658 Th1 and Th2 cell differentiation
    574281 (IL4)
   04659 Th17 cell differentiation
    574281 (IL4)
   04657 IL-17 signaling pathway
    574281 (IL4)
   04664 Fc epsilon RI signaling pathway
    574281 (IL4)
   04672 Intestinal immune network for IgA production
    574281 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574281 (IL4)
  09163 Immune disease
   05310 Asthma
    574281 (IL4)
   05320 Autoimmune thyroid disease
    574281 (IL4)
   05321 Inflammatory bowel disease
    574281 (IL4)
   05330 Allograft rejection
    574281 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    574281 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    574281 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    574281 (IL4)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   574281 (IL4)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Cytokines
   574281 (IL4)
SSDB
Motif
Pfam: IL4 IL13 Mannosyl_trans3
Other DBs
NCBI-GeneID: 574281
NCBI-ProteinID: NP_001028076
Ensembl: ENSMMUG00000003133
UniProt: Q6U8C1 G7MUA8
LinkDB
Position
6
AA seq 153 aa
MGLTSQLLPPLFFLLACAGNFAHGHNCHIALREIIETLNSLTEQKTLCTKLTITDILAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL
NSCPVKEASQSTLEDFLERLKTIMKEKYSKCRS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac
tttgcccacggacacaactgccatatcgccttacgggagatcatcgaaactctgaacagc
ctcacagagcagaagactctgtgcaccaagttgaccataacggacatccttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcgctgcctgggtgcgactgcacagcagtttcacaggcac
aagcagctgatccgattcctgaaacggctcgacaggaacctctggggcctggcgggcttg
aactcctgtcctgtgaaggaagccagccagagtacgttggaagacttcttggaaaggcta
aagacgatcatgaaagagaaatattcaaagtgtcggagctga

KEGG   Macaca mulatta (rhesus monkey): 574282
Entry
574282            CDS       T01028                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma precursor
  KO
K04687  interferon gamma
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03050  Proteasome
mcc04060  Cytokine-cytokine receptor interaction
mcc04066  HIF-1 signaling pathway
mcc04217  Necroptosis
mcc04350  TGF-beta signaling pathway
mcc04380  Osteoclast differentiation
mcc04612  Antigen processing and presentation
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04940  Type I diabetes mellitus
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05144  Malaria
mcc05145  Toxoplasmosis
mcc05146  Amoebiasis
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05164  Influenza A
mcc05168  Herpes simplex virus 1 infection
mcc05200  Pathways in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05321  Inflammatory bowel disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    574282 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    574282 (IFNG)
   04630 JAK-STAT signaling pathway
    574282 (IFNG)
   04066 HIF-1 signaling pathway
    574282 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574282 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    574282 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    574282 (IFNG)
   04612 Antigen processing and presentation
    574282 (IFNG)
   04660 T cell receptor signaling pathway
    574282 (IFNG)
   04658 Th1 and Th2 cell differentiation
    574282 (IFNG)
   04659 Th17 cell differentiation
    574282 (IFNG)
   04657 IL-17 signaling pathway
    574282 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    574282 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574282 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    574282 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    574282 (IFNG)
   05323 Rheumatoid arthritis
    574282 (IFNG)
   05321 Inflammatory bowel disease
    574282 (IFNG)
   05330 Allograft rejection
    574282 (IFNG)
   05332 Graft-versus-host disease
    574282 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    574282 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    574282 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    574282 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    574282 (IFNG)
   05164 Influenza A
    574282 (IFNG)
   05168 Herpes simplex virus 1 infection
    574282 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    574282 (IFNG)
   05144 Malaria
    574282 (IFNG)
   05145 Toxoplasmosis
    574282 (IFNG)
   05140 Leishmaniasis
    574282 (IFNG)
   05142 Chagas disease
    574282 (IFNG)
   05143 African trypanosomiasis
    574282 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mcc03051]
    574282 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    574282 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    574282 (IFNG)
Proteasome [BR:mcc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    574282 (IFNG)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   574282 (IFNG)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Cytokines
   574282 (IFNG)
SSDB
Motif
Pfam: IFN-gamma
Other DBs
NCBI-GeneID: 574282
NCBI-ProteinID: NP_001028077
Ensembl: ENSMMUG00000019225
UniProt: P63310 G7N7K9
LinkDB
Position
11
AA seq 165 aa
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTN
YSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaaatacacaagttatatcttggcttttcagctctgcattgttttgggttctcttggc
tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca
ggtgatccagatgtagcagataatggaactcttttcttagacatcttgaggaattggaaa
gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt
aaaaacttcaaagatgaccagaggatccaaaagagtgtggagaccatcaaggaagacatt
aatgtcaagtttttcaatagcaacaaaaagaaacgggatgactttgaaaagctgaccaat
tattcggtaactgactcgaatgtccaacgcaaagcagtacatgaactcatccaagtgatg
gctgaactgtcgccagcagctaaaatagggaagcgaaaaaggagtcagatgtttcgaggt
cgaagagcatcccaataa

KEGG   Macaca mulatta (rhesus monkey): 574325
Entry
574325            CDS       T01028                                 

Gene name
IL13
Definition
(RefSeq) interleukin-13 precursor
  KO
K05435  interleukin 13
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04664  Fc epsilon RI signaling pathway
mcc05200  Pathways in cancer
mcc05310  Asthma
mcc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    574325 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574325 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    574325 (IL13)
   04657 IL-17 signaling pathway
    574325 (IL13)
   04664 Fc epsilon RI signaling pathway
    574325 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574325 (IL13)
  09163 Immune disease
   05310 Asthma
    574325 (IL13)
   05321 Inflammatory bowel disease
    574325 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    574325 (IL13)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   574325 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 574325
NCBI-ProteinID: NP_001028101
Ensembl: ENSMMUG00000003131
UniProt: Q864V6
LinkDB
Position
6
AA seq 132 aa
MALLLTTVIALTCLGGFASPSPVPRSTALKELIEELVNITQNQKAPLCNGSMVWSINLTA
GVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLV
HLKKLFREGRFN
NT seq 399 nt   +upstreamnt  +downstreamnt
atggcgcttttgttgaccacggtcattgctctcacttgcctcggcggctttgcctcccca
agccctgtgcctcgctctacagccctcaaggagctcattgaggagctggtcaacatcacc
cagaaccagaaggccccgctctgcaatggcagcatggtgtggagcatcaacctgacagct
ggcgtgtactgtgcagccctggaatccctgatcaacgtgtcaggctgcagtgccatcgag
aagacccagaggatgctgaacggattctgcccgcacaaggtctcagctgggcagttttcc
agcttgcgtgtccgagacaccaaaatcgaggtggcccagtttgtaaaggacctgctcgta
catttaaagaaactttttcgcgagggacggttcaactga

KEGG   Macaca mulatta (rhesus monkey): 574371
Entry
574371            CDS       T01028                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor precursor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04657  IL-17 signaling pathway
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc05146  Amoebiasis
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05171  Coronavirus disease - COVID-19
mcc05202  Transcriptional misregulation in cancer
mcc05221  Acute myeloid leukemia
mcc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    574371 (CSF2)
   04668 TNF signaling pathway
    574371 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574371 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    574371 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    574371 (CSF2)
   04660 T cell receptor signaling pathway
    574371 (CSF2)
   04657 IL-17 signaling pathway
    574371 (CSF2)
   04664 Fc epsilon RI signaling pathway
    574371 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    574371 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    574371 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    574371 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    574371 (CSF2)
   05171 Coronavirus disease - COVID-19
    574371 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    574371 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    574371 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcc03019]
    574371 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    574371 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    574371 (CSF2)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     574371 (CSF2)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   574371 (CSF2)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Cytokines
   574371 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 574371
NCBI-ProteinID: NP_001028121
Ensembl: ENSMMUG00000016915
UniProt: Q9GL44 G7MTY3
LinkDB
Position
6
AA seq 144 aa
MWLQGLLLLGTVACSISAPARSPSPGTQPWEHVNAIQEARRLLNLSRDTAAEMNKTVEVV
SEMFDLQEPSCLQTRLELYKQGLQGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
QSFKENLKDFLLVIPFDCWEPVQE
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggctgcagggcctgctgctcttgggcactgtggcctgcagcatctctgcacccgcc
cgctcacccagccccggcacgcagccctgggagcatgtgaatgccatccaggaggcccgg
cgtctcctgaacctgagtagagacactgctgctgagatgaataaaaccgtagaagtcgtc
tcagaaatgtttgacctccaggagccgagctgcctacagacccgcctggagctgtacaag
cagggcctgcagggcagcctcaccaagctcaagggccccttgaccatgatggccagccac
tacaagcagcactgccctccaaccccggaaacttcctgtgcaacccagattatcaccttc
caaagtttcaaagaaaacctgaaggactttctgcttgtcatcccctttgactgctgggag
ccagtccaggagtaa

KEGG   Macaca mulatta (rhesus monkey): 694541
Entry
694541            CDS       T01028                                 

Gene name
IL24
Definition
(RefSeq) interleukin-24
  KO
K22668  interleukin 24
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    694541 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    694541 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    694541 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    694541 (IL24)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   694541 (IL24)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 694541
NCBI-ProteinID: XP_028704488
Ensembl: ENSMMUG00000023572
LinkDB
Position
1
AA seq 227 aa
MEKEEVQGVRVWMGKVGKSRWTDGPASQAASLSFSRPFCPPLLATVSQMQMAVLPCLGLI
LLLWSQVPGVQGQEFQFGPCQVKGVVPQKLWEAFWAVKDTVQSQDNIRSVRLLQQEVLQN
VSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIASQLQPSQENEM
FSIRDSAHRRFLLFRRAFKQLDIEAALTKALGEVDILLTWMQQFYKL
NT seq 684 nt   +upstreamnt  +downstreamnt
atggagaaggaggaggtgcagggcgtgcgggtgtggatgggcaaggtggggaagagcagg
tggactgatgggccggcctcacaggctgcctccctttctttcagcagacccttctgccct
cctttgctggcaacggtctcccaaatgcagatggctgtgctcccttgcctgggtcttatc
ctgcttctctggagccaggtgccaggggtccagggccaagaattccaatttgggccctgc
caagtgaagggggttgttccccagaaactgtgggaagccttctgggctgtgaaagacact
gtgcaatctcaggataacatcaggagtgtccggctgctgcagcaagaggttctgcagaat
gtctcggatgctgagagctgttaccttgtccacaccctgctggagttctacttgaaaact
gttttcaaaaactaccacaatagaacagttgaagtcaggactctgaagtcattctctact
ctggccaacaactttgttctcatcgcgtcacaactgcaacccagtcaggaaaatgagatg
ttttccatcagagacagtgcacacaggcggtttctgctattccggagagcattcaaacag
ttggacatagaagcagctcttaccaaagcccttggggaagtggacattcttctgacctgg
atgcagcaattctacaagctctga

KEGG   Macaca mulatta (rhesus monkey): 694631
Entry
694631            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-1/13-like
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    694631
   04151 PI3K-Akt signaling pathway
    694631
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    694631
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    694631
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    694631
   04621 NOD-like receptor signaling pathway
    694631
   04622 RIG-I-like receptor signaling pathway
    694631
   04623 Cytosolic DNA-sensing pathway
    694631
   04650 Natural killer cell mediated cytotoxicity
    694631
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    694631
  09163 Immune disease
   05320 Autoimmune thyroid disease
    694631
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    694631
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    694631
   05161 Hepatitis B
    694631
   05160 Hepatitis C
    694631
   05171 Coronavirus disease - COVID-19
    694631
   05164 Influenza A
    694631
   05162 Measles
    694631
   05168 Herpes simplex virus 1 infection
    694631
   05163 Human cytomegalovirus infection
    694631
   05167 Kaposi sarcoma-associated herpesvirus infection
    694631
   05169 Epstein-Barr virus infection
    694631
   05165 Human papillomavirus infection
    694631
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    694631
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   694631
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 694631
NCBI-ProteinID: XP_001082177
LinkDB
Position
15
AA seq 239 aa
MESGPGALRKWKSVCSLFKSSARSKAFRKPRAQGSESPISASPEASAISTMALPFALLMA
LVVLSCKSSCSLGCDLPETHSLDNRRTMMLLKQMSRISPSSCLMDRHDFGFPQQEFDGNQ
FQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCAELYQQLNDLEACVMQQERVG
ETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVIRAEIMRSFSLSTNLQERLRRKE
NT seq 720 nt   +upstreamnt  +downstreamnt
atggaaagtggcccaggagcattaagaaagtggaaatcagtatgttccctatttaagtca
tcggctcgaagcaaggccttcagaaaacctagagcccaaggttcagagtcacccatctca
gcaagcccagaagcatctgcaatatctacgatggcattgccctttgctttactgatggcc
ctggtggtgctcagctgcaagtcaagctgctctctgggctgtgatctgcctgagacccac
agcctggataacagaaggaccatgatgctcctgaaacaaatgagcagaatctctccttcc
tcctgtctgatggacagacatgactttggatttccccagcaggagtttgatggcaaccag
ttccagaaggctccagccatctccgtcctccatgagctgatccagcagaccttcaacctc
tttaccacaaaagactcatctgctgcttgggatgaggacctcctagacaaattctgcgct
gaactctaccagcagctgaatgacttggaagcctgtgtcatgcagcaggagagggtggga
gaaactcccctgatgaatgcggactccaccttggctgtgaagaaatacttccgaagaatc
actctctatctgacagagaagaaatacagcccttgtgcctgggaggttatcagagcagaa
atcatgagatccttctctttatcaacaaacttgcaagaaagattaaggaggaaggaataa

KEGG   Macaca mulatta (rhesus monkey): 694689
Entry
694689            CDS       T01028                                 

Gene name
IL20
Definition
(RefSeq) interleukin-20
  KO
K22667  interleukin 20
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    694689 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    694689 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    694689 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    694689 (IL20)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   694689 (IL20)
SSDB
Motif
Pfam: IL10
Other DBs
NCBI-GeneID: 694689
NCBI-ProteinID: XP_014973450
Ensembl: ENSMMUG00000023571
UniProt: F7HHX8
LinkDB
Position
1
AA seq 176 aa
MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNI
DIRILRRTESLQDTKPADQCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIK
KDLRLCHAHMTCHCGEEAMKKYGQILSHFEELEPQAAVVKALGELDILLQWMEETE
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaagcctctagtcttgccttcagccttctctctgctgcgttttatctcctatggact
ccttccactggactgaagacactcaatttgggaagctgtgtgatcgccacaaaccttcag
gaaatacgaaatggattttctgagatacggggcagtgtgcaagccaaagatggaaacatt
gacatcagaatcttaaggaggactgagtctttgcaagacacaaagcctgcggatcagtgc
tgtcttctacgccatttgctacgactctatctggacagagtatttaaaaactaccagacc
cctgaccattatactctccggaagatcagcagcctcgccaattcctttcttaccatcaag
aaggacctccggctctgtcatgcccacatgacatgccattgtggggaggaagcaatgaag
aaatacggccagattctgagtcactttgaagagctggagcctcaggcagcagttgtgaag
gctttgggggaactagacattcttctgcaatggatggaggagacagaatag

KEGG   Macaca mulatta (rhesus monkey): 694747
Entry
694747            CDS       T01028                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta precursor
  KO
K05425  interleukin 12B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04620  Toll-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04940  Type I diabetes mellitus
mcc05133  Pertussis
mcc05134  Legionellosis
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05145  Toxoplasmosis
mcc05146  Amoebiasis
mcc05152  Tuberculosis
mcc05162  Measles
mcc05164  Influenza A
mcc05168  Herpes simplex virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05321  Inflammatory bowel disease
mcc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    694747 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    694747 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    694747 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    694747 (IL12B)
   04625 C-type lectin receptor signaling pathway
    694747 (IL12B)
   04658 Th1 and Th2 cell differentiation
    694747 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    694747 (IL12B)
   05205 Proteoglycans in cancer
    694747 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    694747 (IL12B)
   05330 Allograft rejection
    694747 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    694747 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    694747 (IL12B)
   05134 Legionellosis
    694747 (IL12B)
   05152 Tuberculosis
    694747 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    694747 (IL12B)
   05164 Influenza A
    694747 (IL12B)
   05162 Measles
    694747 (IL12B)
   05168 Herpes simplex virus 1 infection
    694747 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    694747 (IL12B)
   05145 Toxoplasmosis
    694747 (IL12B)
   05140 Leishmaniasis
    694747 (IL12B)
   05142 Chagas disease
    694747 (IL12B)
   05143 African trypanosomiasis
    694747 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    694747 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    694747 (IL12B)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   694747 (IL12B)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Cytokines
   694747 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_2 Ig_5 Ig_3 Ig_4 fn3 I-set
Other DBs
NCBI-GeneID: 694747
NCBI-ProteinID: NP_001038190
Ensembl: ENSMMUG00000021701
UniProt: P48095
LinkDB
Position
6
AA seq 328 aa
MCHQQLVISWFSLVFLASPLMAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERV
RGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSATVIC
RKNASFSVQAQDRYYSSSWSEWASVPCS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtgtcaccagcagctggtcatctcttggttttccctggtttttctggcatctcccctc
atggccatatgggaactgaagaaagacgtttatgttgtagaattggactggtacccggat
gcccctggagaaatggtggtcctcacctgtgacacccctgaagaagatggtatcacctgg
accttggaccagagtggtgaggtcttaggctctggcaaaaccctgaccatccaagtcaaa
gagtttggagatgctggccagtacacctgtcacaaaggaggcgaggctctaagccattca
ctcctgctgcttcacaaaaaggaagatggaatttggtccactgatgttttaaaggaccag
aaagaacccaaaaataagacctttctaagatgtgaggccaaaaattattctggacgtttc
acctgctggtggctgacgacaatcagtactgatctgacattcagtgtcaaaagcagcaga
ggctcttctaacccccaaggggtgacgtgtggagccgttacactctctgcagagagggtc
agaggggacaataaggagtatgagtactcagtggagtgccaggaggacagtgcctgccca
gccgctgaggagaggctgcccattgaggtcatggtggatgccattcacaagctcaagtat
gaaaactacaccagcagcttcttcatcagggacatcatcaaacccgacccacccaagaac
ttgcagctgaagccattaaagaattctcggcaggtggaggtcagctgggagtaccctgac
acctggagtactccacattcctacttctccctgacattctgcatccaggtccagggcaag
agcaagagagaaaagaaagatagaatcttcacagacaagacctcagccacggtcatctgc
cgcaaaaatgccagctttagcgtgcaggcccaggaccgctactatagctcatcttggagc
gaatgggcatctgtgccctgcagttag

KEGG   Macaca mulatta (rhesus monkey): 694806
Entry
694806            CDS       T01028                                 

Gene name
IL19
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-19
  KO
K05444  interleukin 19
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    694806 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    694806 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    694806 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    694806 (IL19)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   694806 (IL19)
SSDB
Motif
Pfam: IL10 DUF1741
Other DBs
NCBI-GeneID: 694806
NCBI-ProteinID: XP_028708472
Ensembl: ENSMMUG00000023570
LinkDB
Position
1
AA seq 215 aa
MCTKGAFPHRSASSLPLXHVCTHISVCVPVLWGSVPWGMKLQCVSLWLLGTILMLCSVDN
HGLRRCLISTDMDHIEDSFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLL
AFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNVTRVIHD
NYDQLEVRSAAVKSLGELDIFLAWIAKNHEVTSSA
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtgcactaagggagcgtttccacacagatctgcatcttccttaccactcnnacatgtg
tgcacacatatatccgtgtgtgtgccagtgctttggggctctgttccatggggcatgaag
ttacagtgtgtttccctttggctcctgggtacaatactgatgttgtgctcagtagacaac
catggtctcaggagatgtctgatttccacagacatggaccatatagaagacagtttccaa
gaaatcaaaagagccatccaagctaaggacaccttcccaaatgtcactatcctgtccaca
ttggagactctgcagatcattaagcccttagatgtgtgctgcgtgaccaagaacctcctg
gcgttctatgtggacagggtgttcaaggatcatcaggagccaaaccccaaaatcttgaga
aaaatcagcagcattgccaactctttcctctacatgcagaaaactctgcggcaatgtcag
gaacagaggcagtgtcactgcaggcaggaagctaccaatgtcaccagagtcatccacgac
aactatgatcagctggaggtccgctctgctgccgtgaaatccctaggagagctcgacatc
tttctagcctggattgctaagaatcatgaagtaacgtcctcggcctga

KEGG   Macaca mulatta (rhesus monkey): 694931
Entry
694931            CDS       T01028                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10 precursor
  KO
K05443  interleukin 10
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04068  FoxO signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04660  T cell receptor signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05144  Malaria
mcc05145  Toxoplasmosis
mcc05146  Amoebiasis
mcc05150  Staphylococcus aureus infection
mcc05152  Tuberculosis
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05321  Inflammatory bowel disease
mcc05322  Systemic lupus erythematosus
mcc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    694931 (IL10)
   04068 FoxO signaling pathway
    694931 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    694931 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    694931 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    694931 (IL10)
   04660 T cell receptor signaling pathway
    694931 (IL10)
   04672 Intestinal immune network for IgA production
    694931 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    694931 (IL10)
   05322 Systemic lupus erythematosus
    694931 (IL10)
   05320 Autoimmune thyroid disease
    694931 (IL10)
   05321 Inflammatory bowel disease
    694931 (IL10)
   05330 Allograft rejection
    694931 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    694931 (IL10)
   05133 Pertussis
    694931 (IL10)
   05150 Staphylococcus aureus infection
    694931 (IL10)
   05152 Tuberculosis
    694931 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    694931 (IL10)
   05144 Malaria
    694931 (IL10)
   05145 Toxoplasmosis
    694931 (IL10)
   05140 Leishmaniasis
    694931 (IL10)
   05142 Chagas disease
    694931 (IL10)
   05143 African trypanosomiasis
    694931 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    694931 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    694931 (IL10)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   694931 (IL10)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Cytokines
   694931 (IL10)
SSDB
Motif
Pfam: IL10 IL22 ALIX_LYPXL_bnd CLZ
Other DBs
NCBI-GeneID: 694931
NCBI-ProteinID: NP_001038192
Ensembl: ENSMMUG00000023569
UniProt: P51496 Q09I13 G7MER0
LinkDB
Position
1
AA seq 178 aa
MHSSALLCCLVLLTGVRASPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQ
LDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcacagctcagcactgctctgttgcctagtcctcctgactggggtgagggccagccca
ggccagggcacccagtctgagaacagctgcacccgcttcccaggcaacctgcctcacatg
cttcgagacctccgagatgccttcagcagagtgaagactttctttcaaatgaaggatcag
ctggacaacatattgttaaaggagtccttgctggaggactttaagggttacctgggttgc
caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac
cacgacccagacatcaaggagcatgtgaactccctgggggagaatctgaagaccctcagg
ctgaggctgcggcgctgtcatcgatttcttccctgtgaaaacaagagcaaggccgtggag
caggtgaagaatgcctttagtaagctccaagagaaaggcgtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctacatgacaatgaagatacaaaactga

KEGG   Macaca mulatta (rhesus monkey): 695997
Entry
695997            CDS       T01028                                 

Gene name
IFNL3
Definition
(RefSeq) interferon lambda-3
  KO
K22669  interferon lambda 2/3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    695997 (IFNL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    695997 (IFNL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    695997 (IFNL3)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   695997 (IFNL3)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 695997
NCBI-ProteinID: XP_001086865
Ensembl: ENSMMUG00000018760
LinkDB
Position
19
AA seq 200 aa
MKLDMTGGCMPVLVLMAAVLTVTGAVPVTRLPGALPDARGCHIAQFKSLSPQELQAFKRA
KDALEESLLLKDCRCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEAAADADSVLV
DVLDQPLHTLHHILSQLRACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESPGCLEASVTF
NLFRLLTRDLKCVASGDLCV
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaactagacatgaccgggggctgcatgccagtgctggtgctgatggccgcagtgctg
accgtgactggagcagttcctgtcaccaggctccccggggctctcccggatgcaaggggc
tgccacatagcccagttcaagtccctgtctccacaggagctgcaggcctttaaaagggcc
aaagatgccttagaagagtcgcttctgctgaaggactgcaggtgccgctcccgcctcttc
cccaggacctgggacctgaggcagctgcaggtgagggagcgccccgtggctttggaggct
gagctggccctgacgctgaaggttctggaggccgccgctgacgctgactcggtcctggtg
gatgtcttggaccagccccttcacaccctgcaccacatcctctcccagctccgggcctgt
atccagcctcagccgacggcagggcccaggccccggggccgcctccaccactggctgcac
cggctccaggaggccccaaaaaaggagtcccctggctgcctcgaggcctctgtcaccttc
aacctcttccgcctcctcacgcgggacctgaaatgtgtcgccagtggggacctgtgtgtt
tga

KEGG   Macaca mulatta (rhesus monkey): 696117
Entry
696117            CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon lambda-2
  KO
K22669  interferon lambda 2/3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    696117
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    696117
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    696117
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   696117
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 696117
NCBI-ProteinID: XP_014979311
LinkDB
Position
19
AA seq 198 aa
MKLDMTGGCMPVLVLMAAVLTVTGAVPVARLPGALPDARGCHIAQFKSLSPQGLXKRAKD
ALEESLLLKDCRCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEAAADADSVLVDV
LDQPLHTLHHILSQLRACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESPGCLEASVTFNL
FRLLTRDLKCVASGDLCV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaaactagacatgaccgggggctgcatgccagtgctggtgctgatggccgcagtgctg
accgtgactggagcagttcctgtcgccaggctccccggggctctcccggatgcaaggggc
tgccacatagcccagttcaagtccctgtctccacagggacttnngaaaagggccaaagat
gccttagaagagtcgcttctgctgaaggactgcaggtgccgctcccgcctcttccccagg
acctgggacctgaggcagctgcaggtgagggagcgccccgtggctttggaggctgagctg
gccctgacgctgaaggttctggaggccgccgctgacgctgactcggtcctggtggatgtc
ttggaccagccccttcacaccctgcaccacatcctctcccagctccgggcctgtatccag
cctcagccgacggcagggcccaggccccggggccgcctccaccactggctgcaccggctc
caggaggccccaaaaaaggagtcccctggctgcctcgaggcctctgtcaccttcaacctc
ttccgcctcctcacgcgggacctgaaatgtgtcgccagcggggacctgtgtgtttga

KEGG   Macaca mulatta (rhesus monkey): 697161
Entry
697161            CDS       T01028                                 

Gene name
IFNL1
Definition
(RefSeq) interferon lambda-1
  KO
K05447  interferon lambda 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    697161 (IFNL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    697161 (IFNL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    697161 (IFNL1)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   697161 (IFNL1)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 697161
NCBI-ProteinID: XP_014979312
Ensembl: ENSMMUG00000010866
UniProt: F7G050
LinkDB
Position
19
AA seq 202 aa
MAAAWIVVLVTLVLGLAVAGPVPTSKPTTTGKGCDIGRFKSLSPQELASFKKARDALEES
LKLKNWSCSSPVFPGNWDLRLLQVRERPGALEAELALTLKVLEAAADTDSALEVVLDQPL
HTLKHILSQLQACIQAQPTAGPRTRGRLHHWLHRLQEASEKESPGCLEASVTFNLFRLLI
RDLTCVANGDLCLRTSTHPEST
NT seq 609 nt   +upstreamnt  +downstreamnt
atggctgcagcttggatcgtggtgctggtgactttggtgctaggcttggccgtggcaggc
cctgtccccacttccaagcccaccacaactgggaagggctgcgacattggcaggttcaaa
tctctgtcaccgcaggagttggcaagcttcaagaaggccagggatgccttggaagagtca
ctcaagttgaaaaactggagttgcagctctcctgtcttccccgggaattgggacctaagg
cttctccaggtgagggagcgccccggggccttggaggctgagctggccctgacgctgaaa
gtcctggaggctgccgctgacactgactcggccctagaggtcgtcctagaccagcccctt
cacaccctgaagcacatcctttcccagctccaggcctgtatccaggctcagcccacagca
gggcccaggacccggggccgcctccaccactggctgcaccggctccaggaggcctccgaa
aaggagtcccctggctgccttgaggcgtctgtcaccttcaacctcttccgcctactcata
cgggacctgacatgtgtcgccaatggggacctgtgtctgagaacgtcaacccaccccgaa
tccacctga

KEGG   Macaca mulatta (rhesus monkey): 699616
Entry
699616            CDS       T01028                                 

Gene name
IL15
Definition
(RefSeq) interleukin-15 precursor
  KO
K05433  interleukin 15
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04668  TNF signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    699616 (IL15)
   04668 TNF signaling pathway
    699616 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    699616 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    699616 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    699616 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    699616 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    699616 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    699616 (IL15)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   699616 (IL15)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 699616
NCBI-ProteinID: NP_001038196
Ensembl: ENSMMUG00000019092
UniProt: P48092
LinkDB
Position
5
AA seq 162 aa
MRISKPHLRSVSIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKI
EDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANN
ILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaatttcgaaaccacatttgagaagtgtttccatccagtgctacttgtgtttactt
ctaaacagtcattttctaactgaagctggcattcatgtcttcattttgggctgtttcagt
gcagggctccctaaaacagaagccaactgggtgaatgtaataagtgatttgaaaaaaatt
gaagatcttattcaatctatgcatattgatgctactttatatacagaaagtgatgttcac
cccagttgcaaggtaacagcaatgaagtgctttctcttggagttgcaagttatttcacat
gagtccggagatacagatattcatgatacagtagaaaatcttatcatcctagcaaacaac
atcttgtcttctaatgggaatataacagaatctggatgcaaagaatgtgaggaactagag
gaaaaaaatattaaagaatttttgcagagttttgtacatattgtccaaatgttcatcaac
acttcttga

KEGG   Macaca mulatta (rhesus monkey): 703205
Entry
703205            CDS       T01028                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04620  Toll-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04940  Type I diabetes mellitus
mcc05133  Pertussis
mcc05134  Legionellosis
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05144  Malaria
mcc05145  Toxoplasmosis
mcc05146  Amoebiasis
mcc05152  Tuberculosis
mcc05162  Measles
mcc05164  Influenza A
mcc05168  Herpes simplex virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05321  Inflammatory bowel disease
mcc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    703205 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    703205 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    703205 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    703205 (IL12A)
   04625 C-type lectin receptor signaling pathway
    703205 (IL12A)
   04658 Th1 and Th2 cell differentiation
    703205 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    703205 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    703205 (IL12A)
   05330 Allograft rejection
    703205 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    703205 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    703205 (IL12A)
   05134 Legionellosis
    703205 (IL12A)
   05152 Tuberculosis
    703205 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    703205 (IL12A)
   05164 Influenza A
    703205 (IL12A)
   05162 Measles
    703205 (IL12A)
   05168 Herpes simplex virus 1 infection
    703205 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    703205 (IL12A)
   05144 Malaria
    703205 (IL12A)
   05145 Toxoplasmosis
    703205 (IL12A)
   05140 Leishmaniasis
    703205 (IL12A)
   05142 Chagas disease
    703205 (IL12A)
   05143 African trypanosomiasis
    703205 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    703205 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    703205 (IL12A)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   703205 (IL12A)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Cytokines
   703205 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 703205
NCBI-ProteinID: NP_001038199
Ensembl: ENSMMUG00000023084
UniProt: P48091
LinkDB
Position
2
AA seq 253 aa
MWPPGSASQPPPSPATATGLHPAARPEPPQCRLSMCPARSLLLVATLVLLDYLSLARNLS
VATPGPEMFPCLHHSQNLLKAASNTLQKARQILEFYPCTSEEIDHEDITKDKTSTVEACL
PLELIKNESCLNSRETSFITNGSCLASRKTSFMMALCLRSIYEDLKMYQVEFKTMNAKLL
RDPKRQIFLDQNILGVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRA
VTIDRVMSYLNAS
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtggccccctgggtcagcctcgcagccaccgccctcacctgccacggccacaggtctg
catccagcggctcgcccagagcccccgcagtgccggctcagcatgtgtccagcgcgcagc
ctcctccttgtggccaccctagtcctcctggactacctcagtttggccagaaacctctcc
gtggccaccccaggcccagaaatgttcccgtgccttcaccactcccaaaacctgctgaag
gccgccagcaacacgcttcagaaggccagacaaattctagaattttacccttgcacttct
gaagagattgatcatgaagatatcacaaaagataaaaccagcacagtagaggcctgttta
ccattggaattaatcaagaatgagagttgcctaaattccagagagacttctttcataact
aatgggagttgcctggcctccagaaagacctcttttatgatggccctgtgccttaggagt
atttatgaagacttgaagatgtaccaagtggagttcaagaccatgaatgcaaagcttctg
agggatcctaagaggcagatctttctagatcaaaacatactgggagttattgatgagctg
atgcaggccctgaatttcaacagtgagactgtgccacaaaaatcctcccttgaagaaccg
gatttttataaaactaaaatcaagctctgcatacttcttcatgctttcagaattcgggca
gtgactattgatagagtgatgagctatctgaatgcttcctaa

KEGG   Macaca mulatta (rhesus monkey): 705819
Entry
705819            CDS       T01028                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6 precursor
  KO
K05405  interleukin 6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01523  Antifolate resistance
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04218  Cellular senescence
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04657  IL-17 signaling pathway
mcc04659  Th17 cell differentiation
mcc04668  TNF signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05010  Alzheimer disease
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05134  Legionellosis
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05144  Malaria
mcc05146  Amoebiasis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05321  Inflammatory bowel disease
mcc05323  Rheumatoid arthritis
mcc05332  Graft-versus-host disease
mcc05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    705819 (IL6)
   04668 TNF signaling pathway
    705819 (IL6)
   04066 HIF-1 signaling pathway
    705819 (IL6)
   04068 FoxO signaling pathway
    705819 (IL6)
   04151 PI3K-Akt signaling pathway
    705819 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    705819 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    705819 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    705819 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    705819 (IL6)
   04620 Toll-like receptor signaling pathway
    705819 (IL6)
   04621 NOD-like receptor signaling pathway
    705819 (IL6)
   04623 Cytosolic DNA-sensing pathway
    705819 (IL6)
   04625 C-type lectin receptor signaling pathway
    705819 (IL6)
   04659 Th17 cell differentiation
    705819 (IL6)
   04657 IL-17 signaling pathway
    705819 (IL6)
   04672 Intestinal immune network for IgA production
    705819 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    705819 (IL6)
   05202 Transcriptional misregulation in cancer
    705819 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    705819 (IL6)
   05321 Inflammatory bowel disease
    705819 (IL6)
   05332 Graft-versus-host disease
    705819 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    705819 (IL6)
   05020 Prion disease
    705819 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    705819 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    705819 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    705819 (IL6)
   04931 Insulin resistance
    705819 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    705819 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    705819 (IL6)
   05135 Yersinia infection
    705819 (IL6)
   05133 Pertussis
    705819 (IL6)
   05134 Legionellosis
    705819 (IL6)
   05152 Tuberculosis
    705819 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    705819 (IL6)
   05161 Hepatitis B
    705819 (IL6)
   05171 Coronavirus disease - COVID-19
    705819 (IL6)
   05164 Influenza A
    705819 (IL6)
   05162 Measles
    705819 (IL6)
   05168 Herpes simplex virus 1 infection
    705819 (IL6)
   05163 Human cytomegalovirus infection
    705819 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    705819 (IL6)
   05169 Epstein-Barr virus infection
    705819 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    705819 (IL6)
   05144 Malaria
    705819 (IL6)
   05142 Chagas disease
    705819 (IL6)
   05143 African trypanosomiasis
    705819 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    705819 (IL6)
   01523 Antifolate resistance
    705819 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    705819 (IL6)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   705819 (IL6)
SSDB
Motif
Pfam: IL6 IL11 IL23 GCSF Phage_int_SAM_1
Other DBs
NCBI-GeneID: 705819
NCBI-ProteinID: NP_001036198
Ensembl: ENSMMUG00000019983
UniProt: A0A1D5QRZ4
LinkDB
Position
3
AA seq 212 aa
MNSVSTSAFGPVAFSLGLLLVLPAAFPAPVLPGEDSKDVAAPHSQPLTSSERIDKHIRYI
LDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactccgtctccacaagcgccttcggtccagttgccttctccctggggctgctcctg
gtgttgcctgctgccttccccgccccagtactcccaggagaagattccaaagatgtagcc
gccccacacagccagccactgacctcttcagaacgaattgacaaacacattcggtacatc
ctcgacggcatctcagccctgagaaaggagacatgtaacaggagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga
tgcttccaatctggattcaatgaggacacttgcctggtgaaaatcatcactggtcttttg
gagtttgaggtatacctagagtacctccagaacaggtttgagagtagtgaggagcaagcc
agagctgtgcaaatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat
ctagatgcaataaccacccctgaaccaaccacaaatgccagcctgctgacgaagctgcag
gcacagaaccagtggctgcaggacatgacgacgcatctcatcctgcgcagctttaaggag
ttcctgcagtccagcctgagggctcttcggcaaatgtaa

KEGG   Macaca mulatta (rhesus monkey): 706194
Entry
706194            CDS       T01028                                 

Gene name
TSLP
Definition
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    706194 (TSLP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    706194 (TSLP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    706194 (TSLP)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   706194 (TSLP)
SSDB
Motif
Pfam: TSLP
Other DBs
NCBI-GeneID: 706194
NCBI-ProteinID: XP_001100503
Ensembl: ENSMMUG00000004669
LinkDB
Position
6
AA seq 159 aa
MKSLGQSKKEEVSFRKFFIFQLVGLVLTYDFTNCDFEKIEADYLRTISKDLITYMSGTKS
TDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINA
TQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaagagtttagggcaaagtaaaaaggaggaagtttctttcaggaaattcttcatcttt
caacttgtagggctggtgctaacttacgacttcactaactgtgactttgagaagattgaa
gcagactatctccgtactatttctaaagacctgattacatatatgagtgggaccaaaagt
accgacttcaacaacaccgtctcctgtagcaatcggccacactgccttactgaaatccag
agcctaaccttcaatcccaccccccgctgcgcgtcgctcgccaaggaaatgttcgccagg
aaaactaaggctaccctcgctctctggtgcccaggctattcggaaactcagataaatgct
actcaggcaatgaagaagaggagaaaaaggaaagtcacaaccaataaatgtctggaacaa
gtgtcacaattactaggattgtggcgtcgcttcattcgaactttactgaaaaaacagtaa

KEGG   Macaca mulatta (rhesus monkey): 706946
Entry
706946            CDS       T01028                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3 precursor
  KO
K04736  interleukin 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04664  Fc epsilon RI signaling pathway
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05221  Acute myeloid leukemia
mcc05310  Asthma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    706946 (IL3)
   04151 PI3K-Akt signaling pathway
    706946 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    706946 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    706946 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    706946 (IL3)
   04664 Fc epsilon RI signaling pathway
    706946 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    706946 (IL3)
   05202 Transcriptional misregulation in cancer
    706946 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    706946 (IL3)
  09163 Immune disease
   05310 Asthma
    706946 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    706946 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    706946 (IL3)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   706946 (IL3)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Cytokines
   706946 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 706946
NCBI-ProteinID: NP_001095204
Ensembl: ENSMMUG00000016912
UniProt: P25140 G7MTY2
LinkDB
Position
6
AA seq 143 aa
MSRLPVLLLLHLLVSPGLQAPMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLN
EEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITN
GDRNDFRRKLKFYLKTLENEQAQ
NT seq 432 nt   +upstreamnt  +downstreamnt
atgagccgcctgcccgtcctgctcctgctccatctcctggtcagccccggactccaagct
cccatgacccagacaacgtccttgaagacaagctgggctaagtgctctaacatgatcgat
gaaattataacacacttaaaccagccacctttgccttcaccggacttcaacaacctcaat
gaggaagaccaaaccattctggtggaaaaaaaccttcgaaggtcaaacctggaggcattc
agtaaggctgtcaagagtttacagaacgcatcagcaatcgagagcattcttaagaatctc
ccaccatgcctgcccatggccacggccgcacccacgcgacctccaatccgtatcacgaac
ggtgaccggaatgacttccggaggaaactgaagttctatctgaaaacccttgagaatgag
caggctcaatag

KEGG   Macaca mulatta (rhesus monkey): 707234
Entry
707234            CDS       T01028                                 

Gene name
IFNK
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04622  RIG-I-like receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    707234 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    707234 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    707234 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    707234 (IFNK)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   707234 (IFNK)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 707234
NCBI-ProteinID: NP_001181223
UniProt: A0A5F7Z7I7 F7G0T5
LinkDB
Position
15
AA seq 207 aa
MSTIPNMIQKCLWLEFLMGTFIAGTLSLDCNLLNVHLRRVTWQNLRLLSSMSNSFPVECL
RENIAFELPQEFLQYTQHMKRDIKKAFYEMSLQTFNIFSQHTFKSGKERHVKQIQIGLDQ
QAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSNLELRRYFNRIDNFLKEKKYSD
CAWEIVRVEIRRCLYYFYKFTALFRRK
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagcaccatacccaacatgattcaaaagtgtctgtggcttgagttccttatgggtacg
ttcattgctggcaccctatccctggactgtaacttactgaatgttcacctgagaagagtc
acctggcaaaatctgagacttctgagtagtatgagcaattcatttcctgtagaatgtcta
cgagaaaacatagcttttgagttgccccaagaatttctacaatacacccagcatatgaag
agggacatcaagaaggccttctatgaaatgtccctacagacattcaacatcttcagccaa
cacaccttcaaatctgggaaagagagacacgtcaaacaaatccaaataggacttgatcag
caagcagagtacctgaaccaatgcttggaggaagacaagaatgaaaatgaagacatgaaa
gaaatgaaagaaaatgagatgaaaccctcagaagccagggtcccccagctgagtaacctc
gaactgaggagatatttcaacaggatagacaatttcctgaaagaaaagaaatacagtgac
tgtgcctgggagattgtccgagtagaaatcagaagatgtttgtactacttttacaaattc
acagctctattcaggaggaaataa

KEGG   Macaca mulatta (rhesus monkey): 708017
Entry
708017            CDS       T01028                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2 precursor
  KO
K05429  interleukin 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04151  PI3K-Akt signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc04940  Type I diabetes mellitus
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
mcc05321  Inflammatory bowel disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    708017 (IL2)
   04151 PI3K-Akt signaling pathway
    708017 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    708017 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    708017 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    708017 (IL2)
   04660 T cell receptor signaling pathway
    708017 (IL2)
   04658 Th1 and Th2 cell differentiation
    708017 (IL2)
   04659 Th17 cell differentiation
    708017 (IL2)
   04672 Intestinal immune network for IgA production
    708017 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    708017 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    708017 (IL2)
   05321 Inflammatory bowel disease
    708017 (IL2)
   05330 Allograft rejection
    708017 (IL2)
   05332 Graft-versus-host disease
    708017 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    708017 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    708017 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    708017 (IL2)
   05171 Coronavirus disease - COVID-19
    708017 (IL2)
   05162 Measles
    708017 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    708017 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    708017 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    708017 (IL2)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   708017 (IL2)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Cytokines
   708017 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 708017
NCBI-ProteinID: NP_001040595
Ensembl: ENSMMUG00000021093
UniProt: P68291
LinkDB
Position
5
AA seq 154 aa
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRDTKDLISNINVIVLELKGS
ETTLMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agagataccaaggacttaatcagcaatatcaacgtaatagttctggaactaaagggatct
gaaacaacactgatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaac
agatggattaccttttgtcaaagcatcatctcaacactgacctga

KEGG   Macaca mulatta (rhesus monkey): 708125
Entry
708125            CDS       T01028                                 

Gene name
IL21
Definition
(RefSeq) interleukin-21 precursor
  KO
K05434  interleukin 21
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04659  Th17 cell differentiation
mcc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    708125 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    708125 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    708125 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    708125 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    708125 (IL21)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   708125 (IL21)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 708125
NCBI-ProteinID: NP_001181171
Ensembl: ENSMMUG00000003346
UniProt: A0A5F7ZHA8 F7EGQ8
LinkDB
Position
5
AA seq 162 aa
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLDPEF
LPAPEDVETNCEWSAISCFQKAQLKSANTGNNERIINLSIKKLKRKSPSTGAERRQKHRL
TCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagatccagtcctggcaacatggagaggatagtcatctgtctgatggtcatcttcttg
gggacactggtccacaaatcaagctcccaaggtcaagatcgccacatgattagaatgcgt
caacttatagatattgttgatcagctgaaaaattatgtgaatgacttggaccctgaattt
ctgccagctccagaagatgtagagacaaactgtgagtggtcagctatttcctgttttcag
aaggcccaactaaagtcagcaaatacaggaaacaatgaaaggataatcaatttatcaatt
aaaaagctgaagaggaaatcaccttccacaggtgcagagagaagacagaaacacagacta
acatgcccttcatgtgattcttatgagaaaaaaccacccaaagaattcctagaaagattc
aaatcacttctccaaaagatgattcatcagcatctgtcctctagaacacatggaagtgaa
gattcctga

KEGG   Macaca mulatta (rhesus monkey): 709559
Entry
709559            CDS       T01028                                 

Gene name
IFNA13
Definition
(RefSeq) interferon alpha-1/13 precursor
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    709559 (IFNA13)
   04151 PI3K-Akt signaling pathway
    709559 (IFNA13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    709559 (IFNA13)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    709559 (IFNA13)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    709559 (IFNA13)
   04621 NOD-like receptor signaling pathway
    709559 (IFNA13)
   04622 RIG-I-like receptor signaling pathway
    709559 (IFNA13)
   04623 Cytosolic DNA-sensing pathway
    709559 (IFNA13)
   04650 Natural killer cell mediated cytotoxicity
    709559 (IFNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    709559 (IFNA13)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    709559 (IFNA13)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    709559 (IFNA13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    709559 (IFNA13)
   05161 Hepatitis B
    709559 (IFNA13)
   05160 Hepatitis C
    709559 (IFNA13)
   05171 Coronavirus disease - COVID-19
    709559 (IFNA13)
   05164 Influenza A
    709559 (IFNA13)
   05162 Measles
    709559 (IFNA13)
   05168 Herpes simplex virus 1 infection
    709559 (IFNA13)
   05163 Human cytomegalovirus infection
    709559 (IFNA13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    709559 (IFNA13)
   05169 Epstein-Barr virus infection
    709559 (IFNA13)
   05165 Human papillomavirus infection
    709559 (IFNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    709559 (IFNA13)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   709559 (IFNA13)
SSDB
Motif
Pfam: Interferon CBF
Other DBs
NCBI-GeneID: 709559
NCBI-ProteinID: NP_001181296
Ensembl: ENSMMUG00000048619
UniProt: A0A5F8AJA6
LinkDB
Position
15
AA seq 190 aa
MMALPFALLMALVVLSSKSSCSLGCDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDF
GFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDL
EACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLST
NLQERLRRKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atgatggccttgccctttgctttactgatggccctggtggtgctcagcagcaagtcaagt
tgctctctgggctgtgatctgcctgagacccacagcctggataacaggaagaccatgatg
ctcctggcacagatgagcagaatctctccttcctcctgtctgatggacagacatgacttt
ggatttccccagcaggagtttgatggcaaccagttccagaaggctccagccatctctgtc
ctccatgagctgatccagcagaccttcaacctctttaccacaaaagactcatctgctgct
tgggatgaggacctcctagacaaattctgcactgaactctaccagcagctgaatgacttg
gaagcctgtgtcatgcagcaggagagggtgggagaaactcccctgatgaatgcggactcc
accttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatac
agcccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaaca
aacttgcaagaaagattaaggaggaaggaataa

KEGG   Macaca mulatta (rhesus monkey): 709755
Entry
709755            CDS       T01028                                 

Gene name
IFNA8
Definition
(RefSeq) interferon alpha-8
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    709755 (IFNA8)
   04151 PI3K-Akt signaling pathway
    709755 (IFNA8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    709755 (IFNA8)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    709755 (IFNA8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    709755 (IFNA8)
   04621 NOD-like receptor signaling pathway
    709755 (IFNA8)
   04622 RIG-I-like receptor signaling pathway
    709755 (IFNA8)
   04623 Cytosolic DNA-sensing pathway
    709755 (IFNA8)
   04650 Natural killer cell mediated cytotoxicity
    709755 (IFNA8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    709755 (IFNA8)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    709755 (IFNA8)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    709755 (IFNA8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    709755 (IFNA8)
   05161 Hepatitis B
    709755 (IFNA8)
   05160 Hepatitis C
    709755 (IFNA8)
   05171 Coronavirus disease - COVID-19
    709755 (IFNA8)
   05164 Influenza A
    709755 (IFNA8)
   05162 Measles
    709755 (IFNA8)
   05168 Herpes simplex virus 1 infection
    709755 (IFNA8)
   05163 Human cytomegalovirus infection
    709755 (IFNA8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    709755 (IFNA8)
   05169 Epstein-Barr virus infection
    709755 (IFNA8)
   05165 Human papillomavirus infection
    709755 (IFNA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    709755 (IFNA8)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   709755 (IFNA8)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 709755
NCBI-ProteinID: XP_001107458
Ensembl: ENSMMUG00000038149
LinkDB
Position
15
AA seq 189 aa
MALTFYLLMALVVLSYKPFSSLGCDLPQTHSLGYRRPLVLLAQMRRISPFSCLKDRHDFE
LPQEEFDDKNFQKAQAISVLHEIIQQTFNLFNTKNSSAAFNETLLDEFYIELDQQLNDLE
SCVMQEVGVTETHLMYEDSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSIN
LQKRLKSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgaccttttatttactgatggccctagtggtgctcagctacaagccattcagc
tctctgggctgtgatctgcctcagacccacagcctgggttacaggaggcccttggtgctc
ctggcacaaatgagaagaatctctcctttctcctgcctgaaggacagacatgactttgaa
ttaccccaggaggagtttgatgacaaaaacttccagaaggctcaagccatctctgtcctc
catgagataatccagcagaccttcaacctcttcaacacaaagaattcatctgctgctttc
aatgagacccttctagatgaattctacatcgaacttgaccagcagttgaatgacctggag
tcctgtgtgatgcaggaagtgggggtgacagagactcacctgatgtacgaggactccatc
ctggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaatcaac
ttgcaaaaaagattgaagagtaaggaataa

KEGG   Macaca mulatta (rhesus monkey): 709948
Entry
709948            CDS       T01028                                 

Gene name
IFNA2
Definition
(RefSeq) interferon alpha-2 precursor
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    709948 (IFNA2)
   04151 PI3K-Akt signaling pathway
    709948 (IFNA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    709948 (IFNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    709948 (IFNA2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    709948 (IFNA2)
   04621 NOD-like receptor signaling pathway
    709948 (IFNA2)
   04622 RIG-I-like receptor signaling pathway
    709948 (IFNA2)
   04623 Cytosolic DNA-sensing pathway
    709948 (IFNA2)
   04650 Natural killer cell mediated cytotoxicity
    709948 (IFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    709948 (IFNA2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    709948 (IFNA2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    709948 (IFNA2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    709948 (IFNA2)
   05161 Hepatitis B
    709948 (IFNA2)
   05160 Hepatitis C
    709948 (IFNA2)
   05171 Coronavirus disease - COVID-19
    709948 (IFNA2)
   05164 Influenza A
    709948 (IFNA2)
   05162 Measles
    709948 (IFNA2)
   05168 Herpes simplex virus 1 infection
    709948 (IFNA2)
   05163 Human cytomegalovirus infection
    709948 (IFNA2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    709948 (IFNA2)
   05169 Epstein-Barr virus infection
    709948 (IFNA2)
   05165 Human papillomavirus infection
    709948 (IFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    709948 (IFNA2)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   709948 (IFNA2)
SSDB
Motif
Pfam: Interferon APC1_C CBF DDHD
Other DBs
NCBI-GeneID: 709948
NCBI-ProteinID: NP_001129266
Ensembl: ENSMMUG00000031806
UniProt: B6CK11
LinkDB
Position
15
AA seq 188 aa
MALTFALLVALVVLSCKSSCSLGCDLPQTHSLGNRRTLMLLAQMRRISLFFCLKDRHDFE
FPQEEFGNQFQKAQTIPVLHEMIQQTFNLFSTKDSSAAWDETLLNKFYTELYQQLNDLEA
CVMQEMGVTETPLMNKNSILAVRKYFQRITLYLKEKKYSLCAWEVVRAEIMRSFSLSTNL
QESLRSKE
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccttgacctttgctttactggtggccctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctacctcaaacccacagcctgggtaacaggaggaccttgatgctc
ctggcacaaatgaggagaatctctcttttcttctgcctgaaggacagacatgactttgaa
tttccccaggaggagtttggcaaccagttccaaaaggctcaaaccatccctgtcctccat
gagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgggat
gagaccctcctaaacaaattctacactgaactctaccagcagctgaatgacctggaagcc
tgtgtgatgcaggagatgggggtgacagagactcccctgatgaacaagaactccatcctg
gccgtgaggaaatacttccaaagaatcactctctatctgaaagagaagaaatacagtctt
tgtgcctgggaggttgtcagagcagaaattatgagatctttttctttgtcaacaaacttg
caagaaagtttaagaagtaaggaatga

KEGG   Macaca mulatta (rhesus monkey): 710487
Entry
710487            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-14
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710487
   04151 PI3K-Akt signaling pathway
    710487
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710487
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    710487
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    710487
   04621 NOD-like receptor signaling pathway
    710487
   04622 RIG-I-like receptor signaling pathway
    710487
   04623 Cytosolic DNA-sensing pathway
    710487
   04650 Natural killer cell mediated cytotoxicity
    710487
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710487
  09163 Immune disease
   05320 Autoimmune thyroid disease
    710487
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710487
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    710487
   05161 Hepatitis B
    710487
   05160 Hepatitis C
    710487
   05171 Coronavirus disease - COVID-19
    710487
   05164 Influenza A
    710487
   05162 Measles
    710487
   05168 Herpes simplex virus 1 infection
    710487
   05163 Human cytomegalovirus infection
    710487
   05167 Kaposi sarcoma-associated herpesvirus infection
    710487
   05169 Epstein-Barr virus infection
    710487
   05165 Human papillomavirus infection
    710487
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    710487
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   710487
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 710487
NCBI-ProteinID: XP_001107576
LinkDB
Position
15
AA seq 219 aa
MHRARSSENLQPRVQGYSSSTSPAASSGFPMALPFALMMALVVLSYKSSCSLGCNPSQTH
NMNNRRTLMLMAQMRRISPFSCLKDRNDFEFPQEEFDGNQFQNTQAISLLHEMIQQTFNL
FSTKDSSAAWDETLLDKFYIELFQQLNDLEACVIQEAGVEETPLMNEDSILAVRKYFQRI
TLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
NT seq 660 nt   +upstreamnt  +downstreamnt
atgcacagagcaaggtcttcagaaaacttacagcccagggttcagggttactcctcatca
accagcccagcagcatcttcaggattcccaatggcattgccctttgctttaatgatggcc
ctggtggtgcttagctacaagtcaagctgctctctgggctgtaatccatctcaaacccac
aacatgaataacaggaggactttgatgctcatggcacaaatgaggagaatctctcctttt
tcatgcctgaaggacagaaatgactttgaatttccccaggaggagtttgatggcaaccag
ttccagaatactcaagccatctctctcctccatgagatgatccagcagaccttcaatctc
ttcagcacaaaggactcatctgctgcttgggatgagaccctcctagacaaattctacatt
gaacttttccagcaactgaatgacctggaagcctgtgtgatacaggaggctggggtagaa
gagactcccctgatgaatgaggactccatcctggctgtgaggaaatacttccaaagaatc
actctctatctgacggagaagaaatacagcccatgtgcctgggaggttgtcagagcagaa
atcatgagatccctctctttttcaacaaacttgcaaaaaagattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 710528
Entry
710528            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-1/13
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710528
   04151 PI3K-Akt signaling pathway
    710528
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710528
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    710528
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    710528
   04621 NOD-like receptor signaling pathway
    710528
   04622 RIG-I-like receptor signaling pathway
    710528
   04623 Cytosolic DNA-sensing pathway
    710528
   04650 Natural killer cell mediated cytotoxicity
    710528
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710528
  09163 Immune disease
   05320 Autoimmune thyroid disease
    710528
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710528
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    710528
   05161 Hepatitis B
    710528
   05160 Hepatitis C
    710528
   05171 Coronavirus disease - COVID-19
    710528
   05164 Influenza A
    710528
   05162 Measles
    710528
   05168 Herpes simplex virus 1 infection
    710528
   05163 Human cytomegalovirus infection
    710528
   05167 Kaposi sarcoma-associated herpesvirus infection
    710528
   05169 Epstein-Barr virus infection
    710528
   05165 Human papillomavirus infection
    710528
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    710528
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   710528
SSDB
Motif
Pfam: Interferon CBF
Other DBs
NCBI-GeneID: 710528
NCBI-ProteinID: XP_014973142
LinkDB
Position
15
AA seq 189 aa
MALPFALLMALVVLSCKSSCSLGCDLPETHSLDNRRTMMLLKQMSRISPSSCLMDRHDFG
FPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLE
ACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcattgccttttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctgcctgagacccacagcctggataacagaaggaccatgatgctc
ctgaaacaaatgagcagaatctctccttcctcctgtctgatggacagacatgactttgga
tttccccagcaggagtttgatggcaaccagttccagaaggctccagccatctctgtcctc
catgagctgatccagcagaccttcaacctctttaccacaaaagactcatctgctgcttgg
gatgaggacctcctagacaaattctgcactgaactctaccagcagctgaatgacttggaa
gcctgtgtcatgcagcaggagagggtgggagaaactcccctgatgaatgcggactccacc
ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatctttctctttatcaacaaac
ttgcaagaaagattaaggaggaaggaataa

KEGG   Macaca mulatta (rhesus monkey): 710568
Entry
710568            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-4-like
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710568
   04151 PI3K-Akt signaling pathway
    710568
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710568
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    710568
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    710568
   04621 NOD-like receptor signaling pathway
    710568
   04622 RIG-I-like receptor signaling pathway
    710568
   04623 Cytosolic DNA-sensing pathway
    710568
   04650 Natural killer cell mediated cytotoxicity
    710568
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710568
  09163 Immune disease
   05320 Autoimmune thyroid disease
    710568
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710568
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    710568
   05161 Hepatitis B
    710568
   05160 Hepatitis C
    710568
   05171 Coronavirus disease - COVID-19
    710568
   05164 Influenza A
    710568
   05162 Measles
    710568
   05168 Herpes simplex virus 1 infection
    710568
   05163 Human cytomegalovirus infection
    710568
   05167 Kaposi sarcoma-associated herpesvirus infection
    710568
   05169 Epstein-Barr virus infection
    710568
   05165 Human papillomavirus infection
    710568
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    710568
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   710568
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 710568
NCBI-ProteinID: XP_014973144
UniProt: A0A5F7Z8I4
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAVVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMQRISLPSCLKDRHDFA
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLE
ACVIQEAGVEETPLMNEDSILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgcctcagacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgcaaagaatctctcttccctcctgcctgaaggacaggcatgactttgca
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gatgagaccctcctagacaaattctacattgaacttttccagcaactgaatgacctggaa
gcctgtgtgatacaggaggctggggtagaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctctatctgatggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 710622
Entry
710622            CDS       T01028                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5 precursor
  KO
K05428  interleukin 5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc05200  Pathways in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05321  Inflammatory bowel disease
mcc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710622 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710622 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    710622 (IL5)
   04660 T cell receptor signaling pathway
    710622 (IL5)
   04658 Th1 and Th2 cell differentiation
    710622 (IL5)
   04657 IL-17 signaling pathway
    710622 (IL5)
   04664 Fc epsilon RI signaling pathway
    710622 (IL5)
   04672 Intestinal immune network for IgA production
    710622 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710622 (IL5)
  09163 Immune disease
   05310 Asthma
    710622 (IL5)
   05320 Autoimmune thyroid disease
    710622 (IL5)
   05321 Inflammatory bowel disease
    710622 (IL5)
   05330 Allograft rejection
    710622 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    710622 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    710622 (IL5)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   710622 (IL5)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Cytokines
   710622 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 710622
NCBI-ProteinID: NP_001348179
Ensembl: ENSMMUG00000048509
LinkDB
Position
6
AA seq 132 aa
MLLHLSLLALGAAYMYAIPTEIPTSALVKETLALLSTHRTLLIGNETLRIPVPVHKHHQL
CTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEF
LGVMNTEWIIES
NT seq 399 nt   +upstreamnt  +downstreamnt
atgcttctacatttgagtttgctagctcttggagctgcttacatgtatgccatccccaca
gaaattcccacaagtgcattggtgaaagagaccttggcactgctttctactcatcgaact
ctgctgataggcaatgagactctgaggattcctgttcctgtacataaacatcaccaactg
tgcactgaagaaatctttcagggaataggcacactggagagtcaaactgtgcaagggggt
actgtggaaagactattcaaaaacttgtctttaataaagaaatacattgacggccaaaaa
aagaaatgtggagaagaaagacggagagtaaaccaattcctagactacctgcaagagttt
cttggtgtaatgaacaccgagtggataatagaaagttga

KEGG   Macaca mulatta (rhesus monkey): 710654
Entry
710654            CDS       T01028                                 

Gene name
IFNA10
Definition
(RefSeq) interferon alpha-4 precursor
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710654 (IFNA10)
   04151 PI3K-Akt signaling pathway
    710654 (IFNA10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710654 (IFNA10)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    710654 (IFNA10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    710654 (IFNA10)
   04621 NOD-like receptor signaling pathway
    710654 (IFNA10)
   04622 RIG-I-like receptor signaling pathway
    710654 (IFNA10)
   04623 Cytosolic DNA-sensing pathway
    710654 (IFNA10)
   04650 Natural killer cell mediated cytotoxicity
    710654 (IFNA10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710654 (IFNA10)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    710654 (IFNA10)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710654 (IFNA10)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    710654 (IFNA10)
   05161 Hepatitis B
    710654 (IFNA10)
   05160 Hepatitis C
    710654 (IFNA10)
   05171 Coronavirus disease - COVID-19
    710654 (IFNA10)
   05164 Influenza A
    710654 (IFNA10)
   05162 Measles
    710654 (IFNA10)
   05168 Herpes simplex virus 1 infection
    710654 (IFNA10)
   05163 Human cytomegalovirus infection
    710654 (IFNA10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    710654 (IFNA10)
   05169 Epstein-Barr virus infection
    710654 (IFNA10)
   05165 Human papillomavirus infection
    710654 (IFNA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    710654 (IFNA10)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   710654 (IFNA10)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 710654
NCBI-ProteinID: NP_001181313
UniProt: A0A5F8A6K8
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAVVVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQTAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSTELYQQLSDLE
ACVIQEAGVGETPLMNEDSILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRKKN
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgccccagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaaggatctctcctttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagacggctcaagccatgtctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaacctcctagaaaaattttccaccgaactttaccagcaactgagtgacttggaa
gcctgtgtgatacaggaggccggggtgggagagactccactgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctctatctgatggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaagaagaattga

KEGG   Macaca mulatta (rhesus monkey): 710751
Entry
710751            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-17-like
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710751
   04151 PI3K-Akt signaling pathway
    710751
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710751
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    710751
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    710751
   04621 NOD-like receptor signaling pathway
    710751
   04622 RIG-I-like receptor signaling pathway
    710751
   04623 Cytosolic DNA-sensing pathway
    710751
   04650 Natural killer cell mediated cytotoxicity
    710751
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710751
  09163 Immune disease
   05320 Autoimmune thyroid disease
    710751
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710751
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    710751
   05161 Hepatitis B
    710751
   05160 Hepatitis C
    710751
   05171 Coronavirus disease - COVID-19
    710751
   05164 Influenza A
    710751
   05162 Measles
    710751
   05168 Herpes simplex virus 1 infection
    710751
   05163 Human cytomegalovirus infection
    710751
   05167 Kaposi sarcoma-associated herpesvirus infection
    710751
   05169 Epstein-Barr virus infection
    710751
   05165 Human papillomavirus infection
    710751
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    710751
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   710751
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 710751
NCBI-ProteinID: XP_014973145
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAMVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSAAWEHSLLEKFSAELYQQLNDLK
ACVIAEPGMEDTPLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccatggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgccccaaacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacacagcctcctagaaaaattttccgctgagctttaccagcaactgaatgacctgaaa
gcctgtgtgatagcagagcctgggatggaagacactcccttgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 710848
Entry
710848            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-17
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710848
   04151 PI3K-Akt signaling pathway
    710848
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710848
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    710848
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    710848
   04621 NOD-like receptor signaling pathway
    710848
   04622 RIG-I-like receptor signaling pathway
    710848
   04623 Cytosolic DNA-sensing pathway
    710848
   04650 Natural killer cell mediated cytotoxicity
    710848
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710848
  09163 Immune disease
   05320 Autoimmune thyroid disease
    710848
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710848
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    710848
   05161 Hepatitis B
    710848
   05160 Hepatitis C
    710848
   05171 Coronavirus disease - COVID-19
    710848
   05164 Influenza A
    710848
   05162 Measles
    710848
   05168 Herpes simplex virus 1 infection
    710848
   05163 Human cytomegalovirus infection
    710848
   05167 Kaposi sarcoma-associated herpesvirus infection
    710848
   05169 Epstein-Barr virus infection
    710848
   05165 Human papillomavirus infection
    710848
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    710848
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   710848
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 710848
NCBI-ProteinID: XP_001107817
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAVVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSAELYQQLNDLK
ACVIAEPGMEDTPLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatcttcctcagacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgggaaggatctctccgttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatgtctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaacctcctagaaaaattttccgctgagctttaccagcaactgaatgacctgaaa
gcctgtgtgatagcagagcctgggatggaagacactcccttgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 711088
Entry
711088            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-17-like
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    711088
   04151 PI3K-Akt signaling pathway
    711088
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    711088
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    711088
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    711088
   04621 NOD-like receptor signaling pathway
    711088
   04622 RIG-I-like receptor signaling pathway
    711088
   04623 Cytosolic DNA-sensing pathway
    711088
   04650 Natural killer cell mediated cytotoxicity
    711088
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    711088
  09163 Immune disease
   05320 Autoimmune thyroid disease
    711088
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    711088
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    711088
   05161 Hepatitis B
    711088
   05160 Hepatitis C
    711088
   05171 Coronavirus disease - COVID-19
    711088
   05164 Influenza A
    711088
   05162 Measles
    711088
   05168 Herpes simplex virus 1 infection
    711088
   05163 Human cytomegalovirus infection
    711088
   05167 Kaposi sarcoma-associated herpesvirus infection
    711088
   05169 Epstein-Barr virus infection
    711088
   05165 Human papillomavirus infection
    711088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    711088
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   711088
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 711088
NCBI-ProteinID: XP_028690319
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAVVVLSYKSICSLGCDLPRTHSLGHRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAVSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSAELYQQLNDLK
ACVIAEPGMEETLLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgcctcggacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccgtctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaacctcctagaaaaattttccgctgagctttaccagcaactgaatgacctgaaa
gcctgtgtgatagcagagcctgggatggaagagactctcttgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaaatacagc
ccatgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 711252
Entry
711252            CDS       T01028                                 

Gene name
IFNA21
Definition
(RefSeq) interferon alpha-21
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    711252 (IFNA21)
   04151 PI3K-Akt signaling pathway
    711252 (IFNA21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    711252 (IFNA21)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    711252 (IFNA21)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    711252 (IFNA21)
   04621 NOD-like receptor signaling pathway
    711252 (IFNA21)
   04622 RIG-I-like receptor signaling pathway
    711252 (IFNA21)
   04623 Cytosolic DNA-sensing pathway
    711252 (IFNA21)
   04650 Natural killer cell mediated cytotoxicity
    711252 (IFNA21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    711252 (IFNA21)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    711252 (IFNA21)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    711252 (IFNA21)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    711252 (IFNA21)
   05161 Hepatitis B
    711252 (IFNA21)
   05160 Hepatitis C
    711252 (IFNA21)
   05171 Coronavirus disease - COVID-19
    711252 (IFNA21)
   05164 Influenza A
    711252 (IFNA21)
   05162 Measles
    711252 (IFNA21)
   05168 Herpes simplex virus 1 infection
    711252 (IFNA21)
   05163 Human cytomegalovirus infection
    711252 (IFNA21)
   05167 Kaposi sarcoma-associated herpesvirus infection
    711252 (IFNA21)
   05169 Epstein-Barr virus infection
    711252 (IFNA21)
   05165 Human papillomavirus infection
    711252 (IFNA21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    711252 (IFNA21)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   711252 (IFNA21)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 711252
NCBI-ProteinID: XP_001108051
LinkDB
Position
15
AA seq 188 aa
MALSFSLLVAVVVLSYKSICSLGCDLPRTHSLGHRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFHKAQAISVLHEMIQQTFNLFSTKDSSAAWEHSLLEKFSTGLYQQLNDLE
ACVIQEVGVEETPLTNVDCILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTT
LQERLRRK
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactggtggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgcctcggacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccacaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacacagcctcctagaaaaattttccactggactttaccagcaactgaatgacctggaa
gcctgtgtgatacaggaggttggagtggaagagactccactgacgaatgtggactgcatc
ctggctgtgaggaaatacttccaaagaatcaccctctatctgatggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttttcaacaacc
ttacaagaaagattaaggaggaagtaa

KEGG   Macaca mulatta (rhesus monkey): 711329
Entry
711329            CDS       T01028                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04622  RIG-I-like receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    711329
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    711329
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    711329
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    711329
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   711329
SSDB
Motif
Pfam: Interferon CDT1_C
Other DBs
NCBI-GeneID: 711329
NCBI-ProteinID: XP_001108113
LinkDB
Position
15
AA seq 220 aa
MSSENLGSNVKPYPAQQSQQHPHFPMALLFPLLAALVMTSYSPVGSLGCDLPQNHGLLSR
NTLVLLHQMRRISPFLCLKDRRDFRFPQEMVEGSQLQKAQVMSVLHEMLQQIFSLFHTER
SSAAWNTTLLDHLHTGLHRQLEHLETCLVQVMREGESAGAIRSPALTLRRYFQGIRVYLK
EKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDGDLGSS
NT seq 663 nt   +upstreamnt  +downstreamnt
atgtcttcagaaaacctagggtccaatgttaagccatatccagctcagcaaagccagcag
caccctcatttcccaatggccctcctcttccctctgctggcagccctagtgatgaccagt
tatagtcctgttggatctctgggctgtgatctgcctcagaaccatggcctacttagcagg
aacaccttggtgcttctgcaccaaatgaggagaatctcccctttcttgtgtctcaaggac
agaagagacttcaggttcccccaggagatggtagaagggagccagctgcagaaggcccag
gtcatgtctgtcctccatgagatgctacagcagatcttcagcctcttccacacagagcgc
tcctctgctgcctggaacacgaccctcctagaccatctccacactggacttcatcggcaa
ctagaacacctggagacctgcttggtgcaggtaatgcgagaaggagaatctgctggggcg
attaggagccctgcactgaccttgaggaggtacttccagggaatccgtgtctacctgaaa
gagaagaaatacagcgactgtgcctgggaagttgtcagaatggaaatcatgaaatccttg
ttcttatcaacaaacatgcaagaaagactgagaagtaaagatggagacctggggtcatct
tga

KEGG   Macaca mulatta (rhesus monkey): 711414
Entry
711414            CDS       T01028                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta precursor
  KO
K05415  interferon beta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04380  Osteoclast differentiation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04668  TNF signaling pathway
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    711414 (IFNB1)
   04668 TNF signaling pathway
    711414 (IFNB1)
   04151 PI3K-Akt signaling pathway
    711414 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    711414 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    711414 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    711414 (IFNB1)
   04621 NOD-like receptor signaling pathway
    711414 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    711414 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    711414 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    711414 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    711414 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    711414 (IFNB1)
   05152 Tuberculosis
    711414 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    711414 (IFNB1)
   05161 Hepatitis B
    711414 (IFNB1)
   05160 Hepatitis C
    711414 (IFNB1)
   05171 Coronavirus disease - COVID-19
    711414 (IFNB1)
   05164 Influenza A
    711414 (IFNB1)
   05162 Measles
    711414 (IFNB1)
   05168 Herpes simplex virus 1 infection
    711414 (IFNB1)
   05163 Human cytomegalovirus infection
    711414 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    711414 (IFNB1)
   05169 Epstein-Barr virus infection
    711414 (IFNB1)
   05165 Human papillomavirus infection
    711414 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    711414 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    711414 (IFNB1)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   711414 (IFNB1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 711414
NCBI-ProteinID: NP_001129267
Ensembl: ENSMMUG00000019067
UniProt: B6CK14
LinkDB
Position
15
AA seq 187 aa
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSSFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVENFLANVYHQIDHLK
TILEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINK
LTGYLRN
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacggctctt
tccatgagctacaacttgcttggattcctacaaagaagcagcagttttcagtgtcagaag
ctcctgtggcaattgaatggaaggcttgaatactgcctcaaggacaggatgaactttgac
atccctgaggaaattaagcagccgcagcagttccagaaggaggacgctgcattgaccatc
tatgagatgctccagaacatcttcgctattttcagacaagatttatctagcactggctgg
aatgagactattgtggagaacttccttgctaatgtctatcatcagatagaccatctgaag
acaatcctagaagaaaaactggagaaagaagatttcaccaggggaaaattcatgagcagt
ttgcacctgaaaagatactatggaaggattctgcattacctgaaggccaaggagtacagt
cactgtgcctggaccatagtcagagtggaaatcctcaggaactttttcttcattaacaaa
cttacaggttacctccgaaactga

KEGG   Macaca mulatta (rhesus monkey): 712292
Entry
712292            CDS       T01028                                 

Gene name
IL9
Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc05310  Asthma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    712292 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    712292 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    712292 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    712292 (IL9)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   712292 (IL9)
SSDB
Other DBs
NCBI-GeneID: 712292
NCBI-ProteinID: XP_001110897
Ensembl: ENSMMUG00000001950
UniProt: G7MUE3
LinkDB
Position
6
AA seq 145 aa
MLLATVLTSALLLCSVAGRGCPTSTGIVMDINFLISKMQEDAASKCHCSANVTSCLCLPI
PSDNCPGPCFREGLSQMTNTTVQTRYPLIFNRVKKSVEVLKNNKCPNFSCEQPCNQTMAG
NTLTFLKSLLEVFQKEKMRGMGGKI
NT seq 438 nt   +upstreamnt  +downstreamnt
atgcttctggccacagtccttacctctgccctgctcctgtgctccgtggcaggccggggg
tgtccaacctccacggggatcgtcatggacatcaacttcctcatcagcaagatgcaggaa
gatgcagcttcgaagtgccactgcagtgctaatgtgaccagttgtctctgtctgcccatt
ccttctgacaactgccctggaccatgcttcagggagggactgtctcagatgaccaatacc
acagtgcaaacaagatacccactgattttcaatcgggtgaaaaaatcggttgaagtacta
aagaacaacaagtgtcccaatttttcctgtgaacagccatgcaaccaaaccatggcaggc
aacacgctgacatttctgaagagtctcctggaagttttccagaaagaaaagatgagaggg
atgggaggcaaaatatga

KEGG   Macaca mulatta (rhesus monkey): 712627
Entry
712627            CDS       T01028                                 

Gene name
IL23A
Definition
(RefSeq) interleukin-23 subunit alpha precursor
  KO
K05426  interleukin 23 subunit alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04659  Th17 cell differentiation
mcc05133  Pertussis
mcc05152  Tuberculosis
mcc05200  Pathways in cancer
mcc05321  Inflammatory bowel disease
mcc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    712627 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    712627 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    712627 (IL23A)
   04659 Th17 cell differentiation
    712627 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    712627 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    712627 (IL23A)
   05321 Inflammatory bowel disease
    712627 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    712627 (IL23A)
   05152 Tuberculosis
    712627 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    712627 (IL23A)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   712627 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 712627
NCBI-ProteinID: NP_001181598
Ensembl: ENSMMUG00000031831
UniProt: F7HQI5 G7N7C7
LinkDB
Position
11
AA seq 189 aa
MLGSRAVMLLLLLSWTAQGRAVPGGSSPAWAQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIRQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSPSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
NT seq 570 nt   +upstreamnt  +downstreamnt
atgctggggagcagagctgtaatgctgctgttgctgctgtcctggacagctcagggcagg
gctgtgcctgggggcagcagccctgcctgggctcagtgccagcagctttcacagaagctc
tgcacactggcctggagtgcacatccactagtgggacacatggatctaagagaagaggga
gatgaagagactacaaatgatgttccccatatccagtgtggagatggctgtgacccccaa
ggactcagggacaacagtcagttctgcttgcaaaggattcgccagggtctgattttttac
gagaagctactgggatcggatattttcacaggggagccttctctgctgcctgatagccct
gtgggccagcttcatgcctccctactgggcctcagccaactcctgcagcctgagggtcac
cactgggagactcagcagattccaagccccagtcccagccagccatggcagcgcctcctt
ctccgcttcaaaatccttcgcagcctccaggcctttgtggctgtagctgcccgggtcttt
gcccatggagcagcaaccctgagcccctaa

KEGG   Macaca mulatta (rhesus monkey): 713850
Entry
713850            CDS       T01028                                 

Gene name
CTF1
Definition
(RefSeq) cardiotrophin-1 isoform X3
  KO
K05422  cardiotrophin 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    713850 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    713850 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    713850 (CTF1)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   713850 (CTF1)
SSDB
Motif
Pfam: LIF_OSM NolB pPIWI_RE_X PRF
Other DBs
NCBI-GeneID: 713850
NCBI-ProteinID: XP_001103315
LinkDB
Position
20
AA seq 200 aa
MSRREGNLDPQADSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSF
SPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDVVRRRQAELNPRAQRLLRR
LEDAARQARALGAAVEALLAALGAANRGPRAEPPTATASAASAAGVFPAKVLGLRVCGLY
REWLSRTEGDLGQLLAGGPA
NT seq 603 nt   +upstreamnt  +downstreamnt
atgagccggagggagggaaatctggacccccaggctgattcctcagtctcacttcttccc
cacttggaggccaagatccgtcagacacacagccttgcgcacctcctcaccaaatacgct
gagcagctgctccaggaatatgtgcagctccagggagaccccttcgggctgcccagcttc
tcaccgccgcggctgccggtggccggcctgagcgccccggctccgagtcacgccgggctg
ccggtgcacgagcggctgcggctggacgcggcggcgctggccgcgctgcccccgctgctg
gacgtagttcgccgccgccaggccgagctgaacccgcgcgcgcagcgcctgctgcgccgc
ctggaggacgcggcacgccaggcccgggccctgggcgccgccgtagaggccttgctggcc
gcgttgggcgccgccaatcgcggaccccgggccgagccccccaccgccaccgcctctgcc
gcctccgccgccggggtcttccccgccaaggtgctgggactccgcgtgtgcggcctctac
cgcgagtggctgagccgcactgagggcgacctgggccagctgctggccgggggcccggcc
tga

KEGG   Macaca mulatta (rhesus monkey): 713903
Entry
713903            CDS       T01028                                 

Definition
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    713903
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    713903
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    713903
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   713903
SSDB
Motif
Pfam: PRF CNTF LIF_OSM
Other DBs
NCBI-GeneID: 713903
NCBI-ProteinID: XP_001103395
LinkDB
Position
20
AA seq 203 aa
MSCPLAHLCLLTLLSPPLSSAAPISPAEPISQAYSLALYMQKNMSMLLQTYLQYQGSPFS
DPGFSAPELQLSSLPPATAFFKTWHALDDGERLSLAQGAFLALTQHLQLVRDDQSDLNPG
SPILLAQLGTARLRAQGLLGNMAAIMTALGLPMPPEEDTLGLVAFGASAFERKCRGYVVT
REYGHWTDRAVRDLALLKAKYPA
NT seq 612 nt   +upstreamnt  +downstreamnt
atgagctgtccactggcccacctctgcctgctgaccctgctgtcgccacccctcagctca
gcagcccccatctccccggctgagcccatcagtcaagcctatagcctggccctctacatg
cagaagaacatgtcaatgctgctgcagacttacctccagtaccagggtagcccctttagt
gaccctggcttctcggcccctgagctccagctcagcagcctgcctcctgccactgccttc
ttcaagacctggcacgccctagatgacggggaaaggctgagccttgcccagggggccttc
ctggccttgacccagcacctccagctcgtgagggacgaccagagcgacctgaaccctggc
agtcccatcctgctggctcagctcgggactgcaagactgagggcccaaggcctgctgggc
aacatggccgccatcatgacagctttggggctgccaatgcccccagaagaggatactcta
gggcttgtcgcctttggggcctcggccttcgagaggaaatgtcgaggctacgtcgtgacc
cgggaatatggccactggacagaccgagctgtgagggacttggctctgctcaaggccaag
tacccagcatag

KEGG   Macaca mulatta (rhesus monkey): 715456
Entry
715456            CDS       T01028                                 

Gene name
LIF
Definition
(RefSeq) leukemia inhibitory factor isoform X1
  KO
K05419  leukemia inhibitory factor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04630  JAK-STAT signaling pathway
mcc04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    715456 (LIF)
   04668 TNF signaling pathway
    715456 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    715456 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    715456 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    715456 (LIF)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   715456 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 715456
NCBI-ProteinID: XP_015005618
Ensembl: ENSMMUG00000048630
LinkDB
Position
10
AA seq 227 aa
MRPLPDPHPVCHDPRPPFPAFLLMASSCLSPGVVPLLLVLHWKHGAGSPLPITPVNATCA
IRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHAN
GTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRL
CSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKETIAVLAQAF
NT seq 684 nt   +upstreamnt  +downstreamnt
atgcgacccttgccagacccccatccggtgtgccatgaccccaggccacccttccctgcc
tttctactcatggcttcttcctgcctgtccccaggagttgtgcccctgctgctggttctg
cactggaaacatggggcagggagccccctccccatcacccctgtcaacgccacctgtgcc
atacgccacccatgtcacaacaacctcatgaaccagatcaggagccaactggcacagctc
aatggcagtgccaatgccctctttattctctattacacagcccagggggagccgttcccc
aacaacctggacaagctgtgcggccccaacgtgacagacttcccgcccttccacgccaac
ggcacggagaaggccaaactggtggagctgtaccgcatagtcgtgtacctcggcacctcc
ctgggcaacatcacccgggaccagaagatcctcaaccccagtgccctcagcctccatagc
aagctcaacgccactgctgacatcctgcgaggcctccttagcaacgtgctgtgccgcctg
tgcagcaagtaccacgtgggccatgtggacgtgacctatggccctgacacctcgggtaag
gacgttttccagaagaagaagctgggctgtcaactcctggggaagtataaggagaccatc
gccgtgttggcccaggccttctag

KEGG   Macaca mulatta (rhesus monkey): 717994
Entry
717994            CDS       T01028                                 

Gene name
OSM
Definition
(RefSeq) oncostatin-M precursor
  KO
K05418  oncostatin M
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    717994 (OSM)
   04151 PI3K-Akt signaling pathway
    717994 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    717994 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    717994 (OSM)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   717994 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 717994
NCBI-ProteinID: NP_001181403
UniProt: F7GF43
LinkDB
Position
10
AA seq 252 aa
MGVPLTQRTLLSLILALLFPSMASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYI
RIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKA
QDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTP
TSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRK
GNRLMPRGQLPR
NT seq 759 nt   +upstreamnt  +downstreamnt
atgggggtaccgctcacacagaggacgctgctcagtctgatccttgcactcctgtttcca
agcatggcaagcatggcggctatgggcagctgctcgaaagagtaccgcatgctccttggc
cagctccagaagcagacagatctcatgcaggacaccagcaggctcctggacccctatata
cgtatccaaggcctggatattcctaaactgagagagcactgcagagagagccctggggcc
ttccccagcgaggagaccctgagggggctgggcaggcggggcttcctacagacgctcaat
gccacactgggccgcgtcctgcacagactggccgacttagagcagcatctccccaaggcc
caggacttggagaggtctgggctgaacatagaggacttagagaagctgcagatggcgagg
ccgaatgtcctcgggctcaggaacaacgtctactgcatggcccagctgctggacaactca
gacatgactgagcccacgaaggccggccgggggacccctcagccgcccacccccacccct
acctcagatgtttttcagcgcaagctggagggctgcagtttcctgcgtggctaccatcgc
ttcatgcactcagtggggcgggtcttcagcaagtggggggagagcccgaaccggagccgg
agacacagcccccaccaggccctgcggaagggggtgcgcaggacgagaccctccaggaaa
ggcaatagactcatgcccaggggacagctgccccggtag

KEGG   Macaca mulatta (rhesus monkey): 718047
Entry
718047            CDS       T01028                                 

Gene name
IL22
Definition
(RefSeq) interleukin-22 precursor
  KO
K05445  interleukin 22
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04659  Th17 cell differentiation
mcc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    718047 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    718047 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    718047 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    718047 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    718047 (IL22)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   718047 (IL22)
SSDB
Motif
Pfam: IL22 IL10 IL28A
Other DBs
NCBI-GeneID: 718047
NCBI-ProteinID: NP_001181653
Ensembl: ENSMMUG00000018724
UniProt: G7N7L0 F6YBU5
LinkDB
Position
11
AA seq 179 aa
MAALQKSVSPFLMGTLATSCLLLLALWVQGGAAAPVSSHCRLDKSNFQQPYITNRTFMLA
KEASSADNNTDVRLIGEKLFRGVSMSERCYLMKQVLNFTLEEVLLPQSDRFQPYMQEVVP
FLARLSNSLSTCHIEGDDLHIQKNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggccgccctgcagaaatctgtgagccctttccttatggggactctggccaccagctgc
ctccttctcttggccctctgggtgcagggaggagcagctgcgcccgtcagctcccactgc
aggcttgacaagtccaacttccagcagccctatatcaccaaccgcaccttcatgctggct
aaggaggctagctcggctgataacaacacagacgttcgtctcattggggaaaaactgttc
cgcggagtcagtatgagtgagcgctgctatctgatgaagcaggtgctgaacttcaccctt
gaagaagtgctgctccctcaatcggataggttccagccttatatgcaggaggtggtgccc
ttcctggccaggctcagcaacagtctaagcacatgtcacattgaaggtgatgacctgcat
atccagaagaatgtccaaaagctgaaggacacagtgaaaaagcttggagagagtggagag
atcaaagcaattggagaactggatttgctgtttatgtctctgagaaatgcctgcatttga

KEGG   Macaca mulatta (rhesus monkey): 721163
Entry
721163            CDS       T01028                                 

Gene name
IL17D
Definition
(RefSeq) interleukin-17D isoform X1
  KO
K05492  interleukin 17D
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04657  IL-17 signaling pathway
mcc04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    721163 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    721163 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    721163 (IL17D)
   04659 Th17 cell differentiation
    721163 (IL17D)
   04657 IL-17 signaling pathway
    721163 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    721163 (IL17D)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   721163 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 721163
NCBI-ProteinID: XP_014976191
LinkDB
Position
17
AA seq 209 aa
MLGALVWMLVAGFLLALPPGWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSA
FHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAY
CLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEP
EKDADSINSSIDKPGAKLLLGPNDAPAGP
NT seq 630 nt   +upstreamnt  +downstreamnt
atgttgggggcactggtctggatgctggtagccggcttcctgctggcgctgccgccgggc
tgggccgcgggcgccccgagggcgggcaggcgcccggcgcggccgcggggctgcgcggac
cggccggaggagctcctggagcagctgtacgggcggctggcggccggcgtgctcagcgcc
ttccaccacacgctgcagctggggccgcgcgagcaggcgcgcaacgcgagctgcccggca
gggggcaggcccgccgaccgccgcttccggccgcccaccaacctgcgtagcgtgtcgccc
tgggcctacagaatctcctacgacccggcgaggtaccccaggtacctgcccgaagcctac
tgcctgtgccggggctgcctgaccgggctgttcggcgaggaggacgtgcgcttccgcagc
gccccggtctacatgcccaccgtggtgctgcgccgcacccccgcctgcgccggcggccgg
tcagtctacaccgaggcctacgtcaccatccccgtgggctgcacctgcgtccccgagccg
gagaaggacgcagacagcatcaactccagcatcgacaaaccgggcgccaagctcctgctg
ggccccaacgacgcgcccgctggcccctga

KEGG   Macaca mulatta (rhesus monkey): 722817
Entry
722817            CDS       T01028                                 

Gene name
IL11
Definition
(RefSeq) interleukin-11
  KO
K05417  interleukin 11
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    722817 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    722817 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    722817 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    722817 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    722817 (IL11)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   722817 (IL11)
SSDB
Motif
Pfam: IL11 CLZ DUF4763
Other DBs
NCBI-GeneID: 722817
NCBI-ProteinID: XP_028694581
Ensembl: ENSMMUG00000048355
LinkDB
Position
19
AA seq 120 aa
MSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRR
LQLLMSRLALPQLPPDPPVPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
NT seq 363 nt   +upstreamnt  +downstreamnt
atgagcgcgggggcactgggagctctacagctcccgagtgtgctgacaaggctgcgagcg
gacctactgtcctacctgcggcatgtgcagtggctgcgtcgggcaatgggctcttccctg
aagaccctggagcctgagctgggcaccctgcagacccggctggaccggctgctgcgccgg
ctgcagctcctgatgtcccgcctggccctgccccagctgcccccagacccgccggtgccc
ccgctggcgcccccctcctcaacctgggggggcatcagggccgcccacgccatcctgggg
gggctgcacctgacacttgactgggccgtgagggggctactgctgctgaagactcggctg
tga

DBGET integrated database retrieval system