KEGG   Macaca mulatta (rhesus monkey): 106992322
Entry
106992322         CDS       T01028                                 

Definition
(RefSeq) interferon alpha-17
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106992322
   04151 PI3K-Akt signaling pathway
    106992322
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106992322
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106992322
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106992322
   04621 NOD-like receptor signaling pathway
    106992322
   04622 RIG-I-like receptor signaling pathway
    106992322
   04623 Cytosolic DNA-sensing pathway
    106992322
   04650 Natural killer cell mediated cytotoxicity
    106992322
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106992322
  09163 Immune disease
   05320 Autoimmune thyroid disease
    106992322
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    106992322
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106992322
   05161 Hepatitis B
    106992322
   05160 Hepatitis C
    106992322
   05171 Coronavirus disease - COVID-19
    106992322
   05164 Influenza A
    106992322
   05162 Measles
    106992322
   05168 Herpes simplex virus 1 infection
    106992322
   05163 Human cytomegalovirus infection
    106992322
   05167 Kaposi sarcoma-associated herpesvirus infection
    106992322
   05169 Epstein-Barr virus infection
    106992322
   05165 Human papillomavirus infection
    106992322
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    106992322
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   106992322
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 106992322
NCBI-ProteinID: XP_014985020
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAVVVLSYKSICSLGCDLPQIHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSAELYQQLNDLK
ACVIAEPGMEDTPLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRTEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggctgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgcctcagatccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaaggatctctccgttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatgtctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaacctcctagaaaaattttccgctgagctttaccagcaactgaatgacctgaaa
gcctgtgtgatagcagagcctgggatggaagacactcccttgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaaatacagc
ccatgtgcctgggaggttgtcagaacagaaatcatgagatctctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 106995851
Entry
106995851         CDS       T01028                                 

Gene name
IFNA6
Definition
(RefSeq) interferon alpha-6
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106995851 (IFNA6)
   04151 PI3K-Akt signaling pathway
    106995851 (IFNA6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106995851 (IFNA6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106995851 (IFNA6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106995851 (IFNA6)
   04621 NOD-like receptor signaling pathway
    106995851 (IFNA6)
   04622 RIG-I-like receptor signaling pathway
    106995851 (IFNA6)
   04623 Cytosolic DNA-sensing pathway
    106995851 (IFNA6)
   04650 Natural killer cell mediated cytotoxicity
    106995851 (IFNA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106995851 (IFNA6)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    106995851 (IFNA6)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    106995851 (IFNA6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106995851 (IFNA6)
   05161 Hepatitis B
    106995851 (IFNA6)
   05160 Hepatitis C
    106995851 (IFNA6)
   05171 Coronavirus disease - COVID-19
    106995851 (IFNA6)
   05164 Influenza A
    106995851 (IFNA6)
   05162 Measles
    106995851 (IFNA6)
   05168 Herpes simplex virus 1 infection
    106995851 (IFNA6)
   05163 Human cytomegalovirus infection
    106995851 (IFNA6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106995851 (IFNA6)
   05169 Epstein-Barr virus infection
    106995851 (IFNA6)
   05165 Human papillomavirus infection
    106995851 (IFNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    106995851 (IFNA6)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   106995851 (IFNA6)
SSDB
Motif
Pfam: Interferon DDHD
Other DBs
NCBI-GeneID: 106995851
NCBI-ProteinID: XP_014984511
LinkDB
Position
15
AA seq 189 aa
MALPFALLMALVVLSCKSSCSLGCDLPQTHSLGHRRTMMLLVQMRRISLFSCLKDRHDFR
FPQEEFDGNQFQKAQAISVLHEVIQQTYNLFSTKDSSAAWDEMLLDKLYTELYQQLNDLE
ACVMQEAWVGETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgccttttgctttactgatggccctggtggtgctcagctgcaagtcaagttgc
tctctgggctgtgatctgcctcagacccacagcctgggtcacaggaggaccatgatgctc
ctggtacaaatgagaagaatctctcttttctcctgtctgaaggacagacacgacttcaga
tttccccaggaggagtttgatggcaaccagttccagaaggctcaagctatctctgtcctc
catgaggtgatccagcagacctacaacctcttcagcacaaaggactcatctgctgcttgg
gatgaaatgcttctagacaaactctacactgaactttaccagcagctgaatgacctggaa
gcctgtgtgatgcaggaggcgtgggtgggagagactcccctgatgaatgaggactccatc
ctggctgtgagaaaatacttccaaagaatcactctctacctgacagagaagaagtatagc
ccttgtgcatgggaggttgtcagagcagaaatcatgagatccttctcttcatcaagaaac
ttgcaagaaagattaaggaggaaggaataa

KEGG   Macaca mulatta (rhesus monkey): 114672663
Entry
114672663         CDS       T01028                                 

Definition
(RefSeq) interferon alpha-17-like
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114672663
   04151 PI3K-Akt signaling pathway
    114672663
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114672663
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    114672663
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114672663
   04621 NOD-like receptor signaling pathway
    114672663
   04622 RIG-I-like receptor signaling pathway
    114672663
   04623 Cytosolic DNA-sensing pathway
    114672663
   04650 Natural killer cell mediated cytotoxicity
    114672663
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114672663
  09163 Immune disease
   05320 Autoimmune thyroid disease
    114672663
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    114672663
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    114672663
   05161 Hepatitis B
    114672663
   05160 Hepatitis C
    114672663
   05171 Coronavirus disease - COVID-19
    114672663
   05164 Influenza A
    114672663
   05162 Measles
    114672663
   05168 Herpes simplex virus 1 infection
    114672663
   05163 Human cytomegalovirus infection
    114672663
   05167 Kaposi sarcoma-associated herpesvirus infection
    114672663
   05169 Epstein-Barr virus infection
    114672663
   05165 Human papillomavirus infection
    114672663
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    114672663
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   114672663
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 114672663
NCBI-ProteinID: XP_028690318
LinkDB
Position
15
AA seq 189 aa
MALSFPLLVAVVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMERISPFSCLKDRRDFG
FPQEEFDGNQFQKAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSAELYQQLNDLK
ACVIAEPGMEETLLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRTEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtcctttcctttactggtggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatcttcctcagacccacagcctgggtcataggagggccttgatactc
ctggcacaaatggaaagaatctctcctttctcctgtctgaaggacagacgtgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatgtctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaacctcctagaaaaattttccgctgagctttaccagcaactgaatgacctgaaa
gcctgtgtgatagcagagcctgggatggaagagactctcttgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaaatacagc
ccttgtgcctgggaggttgtcagaacagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaaggttaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 114672664
Entry
114672664         CDS       T01028                                 

Definition
(RefSeq) interferon alpha-17-like
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114672664
   04151 PI3K-Akt signaling pathway
    114672664
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114672664
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    114672664
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114672664
   04621 NOD-like receptor signaling pathway
    114672664
   04622 RIG-I-like receptor signaling pathway
    114672664
   04623 Cytosolic DNA-sensing pathway
    114672664
   04650 Natural killer cell mediated cytotoxicity
    114672664
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114672664
  09163 Immune disease
   05320 Autoimmune thyroid disease
    114672664
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    114672664
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    114672664
   05161 Hepatitis B
    114672664
   05160 Hepatitis C
    114672664
   05171 Coronavirus disease - COVID-19
    114672664
   05164 Influenza A
    114672664
   05162 Measles
    114672664
   05168 Herpes simplex virus 1 infection
    114672664
   05163 Human cytomegalovirus infection
    114672664
   05167 Kaposi sarcoma-associated herpesvirus infection
    114672664
   05169 Epstein-Barr virus infection
    114672664
   05165 Human papillomavirus infection
    114672664
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    114672664
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   114672664
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 114672664
NCBI-ProteinID: XP_028690320
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAVVVLSYKSICSLGCDPPRTHSLGHRRSLILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSAELYQQLNALE
ACVIAEPGMEETLLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQRKLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatcctccccggacccacagcctgggtcataggaggtccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatgtctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaacctcctagaaaaattttccgctgagctttaccagcaactgaatgccttggaa
gcctgtgtgatagcagagcctgggatggaagagactctcttgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaagtacagc
ccctgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaagaaaattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 694631
Entry
694631            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-1/13-like
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    694631
   04151 PI3K-Akt signaling pathway
    694631
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    694631
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    694631
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    694631
   04621 NOD-like receptor signaling pathway
    694631
   04622 RIG-I-like receptor signaling pathway
    694631
   04623 Cytosolic DNA-sensing pathway
    694631
   04650 Natural killer cell mediated cytotoxicity
    694631
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    694631
  09163 Immune disease
   05320 Autoimmune thyroid disease
    694631
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    694631
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    694631
   05161 Hepatitis B
    694631
   05160 Hepatitis C
    694631
   05171 Coronavirus disease - COVID-19
    694631
   05164 Influenza A
    694631
   05162 Measles
    694631
   05168 Herpes simplex virus 1 infection
    694631
   05163 Human cytomegalovirus infection
    694631
   05167 Kaposi sarcoma-associated herpesvirus infection
    694631
   05169 Epstein-Barr virus infection
    694631
   05165 Human papillomavirus infection
    694631
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    694631
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   694631
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 694631
NCBI-ProteinID: XP_001082177
LinkDB
Position
15
AA seq 239 aa
MESGPGALRKWKSVCSLFKSSARSKAFRKPRAQGSESPISASPEASAISTMALPFALLMA
LVVLSCKSSCSLGCDLPETHSLDNRRTMMLLKQMSRISPSSCLMDRHDFGFPQQEFDGNQ
FQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCAELYQQLNDLEACVMQQERVG
ETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVIRAEIMRSFSLSTNLQERLRRKE
NT seq 720 nt   +upstreamnt  +downstreamnt
atggaaagtggcccaggagcattaagaaagtggaaatcagtatgttccctatttaagtca
tcggctcgaagcaaggccttcagaaaacctagagcccaaggttcagagtcacccatctca
gcaagcccagaagcatctgcaatatctacgatggcattgccctttgctttactgatggcc
ctggtggtgctcagctgcaagtcaagctgctctctgggctgtgatctgcctgagacccac
agcctggataacagaaggaccatgatgctcctgaaacaaatgagcagaatctctccttcc
tcctgtctgatggacagacatgactttggatttccccagcaggagtttgatggcaaccag
ttccagaaggctccagccatctccgtcctccatgagctgatccagcagaccttcaacctc
tttaccacaaaagactcatctgctgcttgggatgaggacctcctagacaaattctgcgct
gaactctaccagcagctgaatgacttggaagcctgtgtcatgcagcaggagagggtggga
gaaactcccctgatgaatgcggactccaccttggctgtgaagaaatacttccgaagaatc
actctctatctgacagagaagaaatacagcccttgtgcctgggaggttatcagagcagaa
atcatgagatccttctctttatcaacaaacttgcaagaaagattaaggaggaaggaataa

KEGG   Macaca mulatta (rhesus monkey): 709559
Entry
709559            CDS       T01028                                 

Gene name
IFNA13
Definition
(RefSeq) interferon alpha-1/13 precursor
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    709559 (IFNA13)
   04151 PI3K-Akt signaling pathway
    709559 (IFNA13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    709559 (IFNA13)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    709559 (IFNA13)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    709559 (IFNA13)
   04621 NOD-like receptor signaling pathway
    709559 (IFNA13)
   04622 RIG-I-like receptor signaling pathway
    709559 (IFNA13)
   04623 Cytosolic DNA-sensing pathway
    709559 (IFNA13)
   04650 Natural killer cell mediated cytotoxicity
    709559 (IFNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    709559 (IFNA13)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    709559 (IFNA13)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    709559 (IFNA13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    709559 (IFNA13)
   05161 Hepatitis B
    709559 (IFNA13)
   05160 Hepatitis C
    709559 (IFNA13)
   05171 Coronavirus disease - COVID-19
    709559 (IFNA13)
   05164 Influenza A
    709559 (IFNA13)
   05162 Measles
    709559 (IFNA13)
   05168 Herpes simplex virus 1 infection
    709559 (IFNA13)
   05163 Human cytomegalovirus infection
    709559 (IFNA13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    709559 (IFNA13)
   05169 Epstein-Barr virus infection
    709559 (IFNA13)
   05165 Human papillomavirus infection
    709559 (IFNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    709559 (IFNA13)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   709559 (IFNA13)
SSDB
Motif
Pfam: Interferon CBF
Other DBs
NCBI-GeneID: 709559
NCBI-ProteinID: NP_001181296
Ensembl: ENSMMUG00000048619
UniProt: A0A5F8AJA6
LinkDB
Position
15
AA seq 190 aa
MMALPFALLMALVVLSSKSSCSLGCDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDF
GFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDL
EACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLST
NLQERLRRKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atgatggccttgccctttgctttactgatggccctggtggtgctcagcagcaagtcaagt
tgctctctgggctgtgatctgcctgagacccacagcctggataacaggaagaccatgatg
ctcctggcacagatgagcagaatctctccttcctcctgtctgatggacagacatgacttt
ggatttccccagcaggagtttgatggcaaccagttccagaaggctccagccatctctgtc
ctccatgagctgatccagcagaccttcaacctctttaccacaaaagactcatctgctgct
tgggatgaggacctcctagacaaattctgcactgaactctaccagcagctgaatgacttg
gaagcctgtgtcatgcagcaggagagggtgggagaaactcccctgatgaatgcggactcc
accttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatac
agcccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaaca
aacttgcaagaaagattaaggaggaaggaataa

KEGG   Macaca mulatta (rhesus monkey): 709755
Entry
709755            CDS       T01028                                 

Gene name
IFNA8
Definition
(RefSeq) interferon alpha-8
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    709755 (IFNA8)
   04151 PI3K-Akt signaling pathway
    709755 (IFNA8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    709755 (IFNA8)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    709755 (IFNA8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    709755 (IFNA8)
   04621 NOD-like receptor signaling pathway
    709755 (IFNA8)
   04622 RIG-I-like receptor signaling pathway
    709755 (IFNA8)
   04623 Cytosolic DNA-sensing pathway
    709755 (IFNA8)
   04650 Natural killer cell mediated cytotoxicity
    709755 (IFNA8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    709755 (IFNA8)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    709755 (IFNA8)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    709755 (IFNA8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    709755 (IFNA8)
   05161 Hepatitis B
    709755 (IFNA8)
   05160 Hepatitis C
    709755 (IFNA8)
   05171 Coronavirus disease - COVID-19
    709755 (IFNA8)
   05164 Influenza A
    709755 (IFNA8)
   05162 Measles
    709755 (IFNA8)
   05168 Herpes simplex virus 1 infection
    709755 (IFNA8)
   05163 Human cytomegalovirus infection
    709755 (IFNA8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    709755 (IFNA8)
   05169 Epstein-Barr virus infection
    709755 (IFNA8)
   05165 Human papillomavirus infection
    709755 (IFNA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    709755 (IFNA8)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   709755 (IFNA8)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 709755
NCBI-ProteinID: XP_001107458
Ensembl: ENSMMUG00000038149
LinkDB
Position
15
AA seq 189 aa
MALTFYLLMALVVLSYKPFSSLGCDLPQTHSLGYRRPLVLLAQMRRISPFSCLKDRHDFE
LPQEEFDDKNFQKAQAISVLHEIIQQTFNLFNTKNSSAAFNETLLDEFYIELDQQLNDLE
SCVMQEVGVTETHLMYEDSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSIN
LQKRLKSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgaccttttatttactgatggccctagtggtgctcagctacaagccattcagc
tctctgggctgtgatctgcctcagacccacagcctgggttacaggaggcccttggtgctc
ctggcacaaatgagaagaatctctcctttctcctgcctgaaggacagacatgactttgaa
ttaccccaggaggagtttgatgacaaaaacttccagaaggctcaagccatctctgtcctc
catgagataatccagcagaccttcaacctcttcaacacaaagaattcatctgctgctttc
aatgagacccttctagatgaattctacatcgaacttgaccagcagttgaatgacctggag
tcctgtgtgatgcaggaagtgggggtgacagagactcacctgatgtacgaggactccatc
ctggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaatcaac
ttgcaaaaaagattgaagagtaaggaataa

KEGG   Macaca mulatta (rhesus monkey): 709948
Entry
709948            CDS       T01028                                 

Gene name
IFNA2
Definition
(RefSeq) interferon alpha-2 precursor
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    709948 (IFNA2)
   04151 PI3K-Akt signaling pathway
    709948 (IFNA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    709948 (IFNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    709948 (IFNA2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    709948 (IFNA2)
   04621 NOD-like receptor signaling pathway
    709948 (IFNA2)
   04622 RIG-I-like receptor signaling pathway
    709948 (IFNA2)
   04623 Cytosolic DNA-sensing pathway
    709948 (IFNA2)
   04650 Natural killer cell mediated cytotoxicity
    709948 (IFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    709948 (IFNA2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    709948 (IFNA2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    709948 (IFNA2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    709948 (IFNA2)
   05161 Hepatitis B
    709948 (IFNA2)
   05160 Hepatitis C
    709948 (IFNA2)
   05171 Coronavirus disease - COVID-19
    709948 (IFNA2)
   05164 Influenza A
    709948 (IFNA2)
   05162 Measles
    709948 (IFNA2)
   05168 Herpes simplex virus 1 infection
    709948 (IFNA2)
   05163 Human cytomegalovirus infection
    709948 (IFNA2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    709948 (IFNA2)
   05169 Epstein-Barr virus infection
    709948 (IFNA2)
   05165 Human papillomavirus infection
    709948 (IFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    709948 (IFNA2)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   709948 (IFNA2)
SSDB
Motif
Pfam: Interferon APC1_C CBF DDHD
Other DBs
NCBI-GeneID: 709948
NCBI-ProteinID: NP_001129266
Ensembl: ENSMMUG00000031806
UniProt: B6CK11
LinkDB
Position
15
AA seq 188 aa
MALTFALLVALVVLSCKSSCSLGCDLPQTHSLGNRRTLMLLAQMRRISLFFCLKDRHDFE
FPQEEFGNQFQKAQTIPVLHEMIQQTFNLFSTKDSSAAWDETLLNKFYTELYQQLNDLEA
CVMQEMGVTETPLMNKNSILAVRKYFQRITLYLKEKKYSLCAWEVVRAEIMRSFSLSTNL
QESLRSKE
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccttgacctttgctttactggtggccctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctacctcaaacccacagcctgggtaacaggaggaccttgatgctc
ctggcacaaatgaggagaatctctcttttcttctgcctgaaggacagacatgactttgaa
tttccccaggaggagtttggcaaccagttccaaaaggctcaaaccatccctgtcctccat
gagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgggat
gagaccctcctaaacaaattctacactgaactctaccagcagctgaatgacctggaagcc
tgtgtgatgcaggagatgggggtgacagagactcccctgatgaacaagaactccatcctg
gccgtgaggaaatacttccaaagaatcactctctatctgaaagagaagaaatacagtctt
tgtgcctgggaggttgtcagagcagaaattatgagatctttttctttgtcaacaaacttg
caagaaagtttaagaagtaaggaatga

KEGG   Macaca mulatta (rhesus monkey): 710487
Entry
710487            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-14
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710487
   04151 PI3K-Akt signaling pathway
    710487
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710487
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    710487
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    710487
   04621 NOD-like receptor signaling pathway
    710487
   04622 RIG-I-like receptor signaling pathway
    710487
   04623 Cytosolic DNA-sensing pathway
    710487
   04650 Natural killer cell mediated cytotoxicity
    710487
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710487
  09163 Immune disease
   05320 Autoimmune thyroid disease
    710487
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710487
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    710487
   05161 Hepatitis B
    710487
   05160 Hepatitis C
    710487
   05171 Coronavirus disease - COVID-19
    710487
   05164 Influenza A
    710487
   05162 Measles
    710487
   05168 Herpes simplex virus 1 infection
    710487
   05163 Human cytomegalovirus infection
    710487
   05167 Kaposi sarcoma-associated herpesvirus infection
    710487
   05169 Epstein-Barr virus infection
    710487
   05165 Human papillomavirus infection
    710487
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    710487
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   710487
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 710487
NCBI-ProteinID: XP_001107576
LinkDB
Position
15
AA seq 219 aa
MHRARSSENLQPRVQGYSSSTSPAASSGFPMALPFALMMALVVLSYKSSCSLGCNPSQTH
NMNNRRTLMLMAQMRRISPFSCLKDRNDFEFPQEEFDGNQFQNTQAISLLHEMIQQTFNL
FSTKDSSAAWDETLLDKFYIELFQQLNDLEACVIQEAGVEETPLMNEDSILAVRKYFQRI
TLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
NT seq 660 nt   +upstreamnt  +downstreamnt
atgcacagagcaaggtcttcagaaaacttacagcccagggttcagggttactcctcatca
accagcccagcagcatcttcaggattcccaatggcattgccctttgctttaatgatggcc
ctggtggtgcttagctacaagtcaagctgctctctgggctgtaatccatctcaaacccac
aacatgaataacaggaggactttgatgctcatggcacaaatgaggagaatctctcctttt
tcatgcctgaaggacagaaatgactttgaatttccccaggaggagtttgatggcaaccag
ttccagaatactcaagccatctctctcctccatgagatgatccagcagaccttcaatctc
ttcagcacaaaggactcatctgctgcttgggatgagaccctcctagacaaattctacatt
gaacttttccagcaactgaatgacctggaagcctgtgtgatacaggaggctggggtagaa
gagactcccctgatgaatgaggactccatcctggctgtgaggaaatacttccaaagaatc
actctctatctgacggagaagaaatacagcccatgtgcctgggaggttgtcagagcagaa
atcatgagatccctctctttttcaacaaacttgcaaaaaagattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 710528
Entry
710528            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-1/13
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710528
   04151 PI3K-Akt signaling pathway
    710528
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710528
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    710528
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    710528
   04621 NOD-like receptor signaling pathway
    710528
   04622 RIG-I-like receptor signaling pathway
    710528
   04623 Cytosolic DNA-sensing pathway
    710528
   04650 Natural killer cell mediated cytotoxicity
    710528
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710528
  09163 Immune disease
   05320 Autoimmune thyroid disease
    710528
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710528
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    710528
   05161 Hepatitis B
    710528
   05160 Hepatitis C
    710528
   05171 Coronavirus disease - COVID-19
    710528
   05164 Influenza A
    710528
   05162 Measles
    710528
   05168 Herpes simplex virus 1 infection
    710528
   05163 Human cytomegalovirus infection
    710528
   05167 Kaposi sarcoma-associated herpesvirus infection
    710528
   05169 Epstein-Barr virus infection
    710528
   05165 Human papillomavirus infection
    710528
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    710528
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   710528
SSDB
Motif
Pfam: Interferon CBF
Other DBs
NCBI-GeneID: 710528
NCBI-ProteinID: XP_014973142
LinkDB
Position
15
AA seq 189 aa
MALPFALLMALVVLSCKSSCSLGCDLPETHSLDNRRTMMLLKQMSRISPSSCLMDRHDFG
FPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLE
ACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcattgccttttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctgcctgagacccacagcctggataacagaaggaccatgatgctc
ctgaaacaaatgagcagaatctctccttcctcctgtctgatggacagacatgactttgga
tttccccagcaggagtttgatggcaaccagttccagaaggctccagccatctctgtcctc
catgagctgatccagcagaccttcaacctctttaccacaaaagactcatctgctgcttgg
gatgaggacctcctagacaaattctgcactgaactctaccagcagctgaatgacttggaa
gcctgtgtcatgcagcaggagagggtgggagaaactcccctgatgaatgcggactccacc
ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatctttctctttatcaacaaac
ttgcaagaaagattaaggaggaaggaataa

KEGG   Macaca mulatta (rhesus monkey): 710568
Entry
710568            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-4-like
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710568
   04151 PI3K-Akt signaling pathway
    710568
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710568
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    710568
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    710568
   04621 NOD-like receptor signaling pathway
    710568
   04622 RIG-I-like receptor signaling pathway
    710568
   04623 Cytosolic DNA-sensing pathway
    710568
   04650 Natural killer cell mediated cytotoxicity
    710568
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710568
  09163 Immune disease
   05320 Autoimmune thyroid disease
    710568
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710568
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    710568
   05161 Hepatitis B
    710568
   05160 Hepatitis C
    710568
   05171 Coronavirus disease - COVID-19
    710568
   05164 Influenza A
    710568
   05162 Measles
    710568
   05168 Herpes simplex virus 1 infection
    710568
   05163 Human cytomegalovirus infection
    710568
   05167 Kaposi sarcoma-associated herpesvirus infection
    710568
   05169 Epstein-Barr virus infection
    710568
   05165 Human papillomavirus infection
    710568
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    710568
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   710568
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 710568
NCBI-ProteinID: XP_014973144
UniProt: A0A5F7Z8I4
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAVVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMQRISLPSCLKDRHDFA
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLE
ACVIQEAGVEETPLMNEDSILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgcctcagacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgcaaagaatctctcttccctcctgcctgaaggacaggcatgactttgca
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gatgagaccctcctagacaaattctacattgaacttttccagcaactgaatgacctggaa
gcctgtgtgatacaggaggctggggtagaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctctatctgatggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 710654
Entry
710654            CDS       T01028                                 

Gene name
IFNA10
Definition
(RefSeq) interferon alpha-4 precursor
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710654 (IFNA10)
   04151 PI3K-Akt signaling pathway
    710654 (IFNA10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710654 (IFNA10)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    710654 (IFNA10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    710654 (IFNA10)
   04621 NOD-like receptor signaling pathway
    710654 (IFNA10)
   04622 RIG-I-like receptor signaling pathway
    710654 (IFNA10)
   04623 Cytosolic DNA-sensing pathway
    710654 (IFNA10)
   04650 Natural killer cell mediated cytotoxicity
    710654 (IFNA10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710654 (IFNA10)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    710654 (IFNA10)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710654 (IFNA10)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    710654 (IFNA10)
   05161 Hepatitis B
    710654 (IFNA10)
   05160 Hepatitis C
    710654 (IFNA10)
   05171 Coronavirus disease - COVID-19
    710654 (IFNA10)
   05164 Influenza A
    710654 (IFNA10)
   05162 Measles
    710654 (IFNA10)
   05168 Herpes simplex virus 1 infection
    710654 (IFNA10)
   05163 Human cytomegalovirus infection
    710654 (IFNA10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    710654 (IFNA10)
   05169 Epstein-Barr virus infection
    710654 (IFNA10)
   05165 Human papillomavirus infection
    710654 (IFNA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    710654 (IFNA10)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   710654 (IFNA10)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 710654
NCBI-ProteinID: NP_001181313
UniProt: A0A5F8A6K8
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAVVVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQTAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSTELYQQLSDLE
ACVIQEAGVGETPLMNEDSILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRKKN
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgccccagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaaggatctctcctttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagacggctcaagccatgtctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaacctcctagaaaaattttccaccgaactttaccagcaactgagtgacttggaa
gcctgtgtgatacaggaggccggggtgggagagactccactgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctctatctgatggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaagaagaattga

KEGG   Macaca mulatta (rhesus monkey): 710751
Entry
710751            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-17-like
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710751
   04151 PI3K-Akt signaling pathway
    710751
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710751
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    710751
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    710751
   04621 NOD-like receptor signaling pathway
    710751
   04622 RIG-I-like receptor signaling pathway
    710751
   04623 Cytosolic DNA-sensing pathway
    710751
   04650 Natural killer cell mediated cytotoxicity
    710751
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710751
  09163 Immune disease
   05320 Autoimmune thyroid disease
    710751
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710751
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    710751
   05161 Hepatitis B
    710751
   05160 Hepatitis C
    710751
   05171 Coronavirus disease - COVID-19
    710751
   05164 Influenza A
    710751
   05162 Measles
    710751
   05168 Herpes simplex virus 1 infection
    710751
   05163 Human cytomegalovirus infection
    710751
   05167 Kaposi sarcoma-associated herpesvirus infection
    710751
   05169 Epstein-Barr virus infection
    710751
   05165 Human papillomavirus infection
    710751
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    710751
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   710751
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 710751
NCBI-ProteinID: XP_014973145
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAMVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSAAWEHSLLEKFSAELYQQLNDLK
ACVIAEPGMEDTPLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccatggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgccccaaacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacacagcctcctagaaaaattttccgctgagctttaccagcaactgaatgacctgaaa
gcctgtgtgatagcagagcctgggatggaagacactcccttgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 710848
Entry
710848            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-17
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710848
   04151 PI3K-Akt signaling pathway
    710848
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710848
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    710848
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    710848
   04621 NOD-like receptor signaling pathway
    710848
   04622 RIG-I-like receptor signaling pathway
    710848
   04623 Cytosolic DNA-sensing pathway
    710848
   04650 Natural killer cell mediated cytotoxicity
    710848
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710848
  09163 Immune disease
   05320 Autoimmune thyroid disease
    710848
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710848
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    710848
   05161 Hepatitis B
    710848
   05160 Hepatitis C
    710848
   05171 Coronavirus disease - COVID-19
    710848
   05164 Influenza A
    710848
   05162 Measles
    710848
   05168 Herpes simplex virus 1 infection
    710848
   05163 Human cytomegalovirus infection
    710848
   05167 Kaposi sarcoma-associated herpesvirus infection
    710848
   05169 Epstein-Barr virus infection
    710848
   05165 Human papillomavirus infection
    710848
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    710848
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   710848
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 710848
NCBI-ProteinID: XP_001107817
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAVVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSAELYQQLNDLK
ACVIAEPGMEDTPLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatcttcctcagacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgggaaggatctctccgttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatgtctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaacctcctagaaaaattttccgctgagctttaccagcaactgaatgacctgaaa
gcctgtgtgatagcagagcctgggatggaagacactcccttgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 711088
Entry
711088            CDS       T01028                                 

Definition
(RefSeq) interferon alpha-17-like
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    711088
   04151 PI3K-Akt signaling pathway
    711088
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    711088
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    711088
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    711088
   04621 NOD-like receptor signaling pathway
    711088
   04622 RIG-I-like receptor signaling pathway
    711088
   04623 Cytosolic DNA-sensing pathway
    711088
   04650 Natural killer cell mediated cytotoxicity
    711088
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    711088
  09163 Immune disease
   05320 Autoimmune thyroid disease
    711088
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    711088
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    711088
   05161 Hepatitis B
    711088
   05160 Hepatitis C
    711088
   05171 Coronavirus disease - COVID-19
    711088
   05164 Influenza A
    711088
   05162 Measles
    711088
   05168 Herpes simplex virus 1 infection
    711088
   05163 Human cytomegalovirus infection
    711088
   05167 Kaposi sarcoma-associated herpesvirus infection
    711088
   05169 Epstein-Barr virus infection
    711088
   05165 Human papillomavirus infection
    711088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    711088
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   711088
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 711088
NCBI-ProteinID: XP_028690319
LinkDB
Position
15
AA seq 189 aa
MALSFSLLMAVVVLSYKSICSLGCDLPRTHSLGHRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAVSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSAELYQQLNDLK
ACVIAEPGMEETLLMNEDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgcctcggacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccgtctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaacctcctagaaaaattttccgctgagctttaccagcaactgaatgacctgaaa
gcctgtgtgatagcagagcctgggatggaagagactctcttgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctctatctgacggagaagaaatacagc
ccatgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Macaca mulatta (rhesus monkey): 711252
Entry
711252            CDS       T01028                                 

Gene name
IFNA21
Definition
(RefSeq) interferon alpha-21
  KO
K05414  interferon alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    711252 (IFNA21)
   04151 PI3K-Akt signaling pathway
    711252 (IFNA21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    711252 (IFNA21)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    711252 (IFNA21)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    711252 (IFNA21)
   04621 NOD-like receptor signaling pathway
    711252 (IFNA21)
   04622 RIG-I-like receptor signaling pathway
    711252 (IFNA21)
   04623 Cytosolic DNA-sensing pathway
    711252 (IFNA21)
   04650 Natural killer cell mediated cytotoxicity
    711252 (IFNA21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    711252 (IFNA21)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    711252 (IFNA21)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    711252 (IFNA21)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    711252 (IFNA21)
   05161 Hepatitis B
    711252 (IFNA21)
   05160 Hepatitis C
    711252 (IFNA21)
   05171 Coronavirus disease - COVID-19
    711252 (IFNA21)
   05164 Influenza A
    711252 (IFNA21)
   05162 Measles
    711252 (IFNA21)
   05168 Herpes simplex virus 1 infection
    711252 (IFNA21)
   05163 Human cytomegalovirus infection
    711252 (IFNA21)
   05167 Kaposi sarcoma-associated herpesvirus infection
    711252 (IFNA21)
   05169 Epstein-Barr virus infection
    711252 (IFNA21)
   05165 Human papillomavirus infection
    711252 (IFNA21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    711252 (IFNA21)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   711252 (IFNA21)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 711252
NCBI-ProteinID: XP_001108051
LinkDB
Position
15
AA seq 188 aa
MALSFSLLVAVVVLSYKSICSLGCDLPRTHSLGHRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFHKAQAISVLHEMIQQTFNLFSTKDSSAAWEHSLLEKFSTGLYQQLNDLE
ACVIQEVGVEETPLTNVDCILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTT
LQERLRRK
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactggtggccgtggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgcctcggacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgtctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccacaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacacagcctcctagaaaaattttccactggactttaccagcaactgaatgacctggaa
gcctgtgtgatacaggaggttggagtggaagagactccactgacgaatgtggactgcatc
ctggctgtgaggaaatacttccaaagaatcaccctctatctgatggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttttcaacaacc
ttacaagaaagattaaggaggaagtaa

DBGET integrated database retrieval system