KEGG   Macaca mulatta (rhesus monkey): 106992736
Entry
106992736         CDS       T01028                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04012  ErbB signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04136  Autophagy - other
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04218  Cellular senescence
mcc04371  Apelin signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04630  JAK-STAT signaling pathway
mcc04659  Th17 cell differentiation
mcc04714  Thermogenesis
mcc04910  Insulin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04935  Growth hormone synthesis, secretion and action
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05221  Acute myeloid leukemia
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106992736 (MTOR)
   04371 Apelin signaling pathway
    106992736 (MTOR)
   04630 JAK-STAT signaling pathway
    106992736 (MTOR)
   04066 HIF-1 signaling pathway
    106992736 (MTOR)
   04072 Phospholipase D signaling pathway
    106992736 (MTOR)
   04151 PI3K-Akt signaling pathway
    106992736 (MTOR)
   04152 AMPK signaling pathway
    106992736 (MTOR)
   04150 mTOR signaling pathway
    106992736 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106992736 (MTOR)
   04136 Autophagy - other
    106992736 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    106992736 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    106992736 (MTOR)
   04659 Th17 cell differentiation
    106992736 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    106992736 (MTOR)
   04920 Adipocytokine signaling pathway
    106992736 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    106992736 (MTOR)
   04919 Thyroid hormone signaling pathway
    106992736 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    106992736 (MTOR)
   04213 Longevity regulating pathway - multiple species
    106992736 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    106992736 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106992736 (MTOR)
   05206 MicroRNAs in cancer
    106992736 (MTOR)
   05205 Proteoglycans in cancer
    106992736 (MTOR)
   05230 Central carbon metabolism in cancer
    106992736 (MTOR)
   05231 Choline metabolism in cancer
    106992736 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106992736 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106992736 (MTOR)
   05212 Pancreatic cancer
    106992736 (MTOR)
   05225 Hepatocellular carcinoma
    106992736 (MTOR)
   05226 Gastric cancer
    106992736 (MTOR)
   05214 Glioma
    106992736 (MTOR)
   05221 Acute myeloid leukemia
    106992736 (MTOR)
   05215 Prostate cancer
    106992736 (MTOR)
   05224 Breast cancer
    106992736 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106992736 (MTOR)
   05014 Amyotrophic lateral sclerosis
    106992736 (MTOR)
   05016 Huntington disease
    106992736 (MTOR)
   05017 Spinocerebellar ataxia
    106992736 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    106992736 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    106992736 (MTOR)
   04931 Insulin resistance
    106992736 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106992736 (MTOR)
   05168 Herpes simplex virus 1 infection
    106992736 (MTOR)
   05163 Human cytomegalovirus infection
    106992736 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106992736 (MTOR)
   05165 Human papillomavirus infection
    106992736 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106992736 (MTOR)
   01522 Endocrine resistance
    106992736 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    106992736 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    106992736 (MTOR)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106992736 (MTOR)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   106992736 (MTOR)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    106992736 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 106992736
NCBI-ProteinID: XP_014966586
Ensembl: ENSMMUG00000019325
UniProt: H9ENS2
LinkDB
Position
1
AA seq 2549 aa
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPSIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNTTTAATTAATATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgcttggaaccggacctgccgccgccaccaccgctgccaccacatctagcaatgtgagt
gttctacagcagtttgccagtggcctgaagagccggaatgaagagaccagggccaaagct
gccaaggagctccagcactatgtcaccatggaactccgagagatgagtcaagaggagtct
actcgcttctatgaccagctgaaccatcacatttttgaattggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtgggaat
gccacccgaattggcagatttgccaactatcttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccatcggccgccttgccatggcaggagacactttc
accgctgagtatgtggaatttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacacgcagctgtcctggttctccgtgagctggccatcagcgtccct
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaaacaagccatccgtgagggagctgtggccgcccttcgtgcctgtttgattctcacc
acccagcgtgagccgaaggagatgcagaagcctcagtggtacaggcacacatttgaagaa
gcagagaaagggtttgatgagaccttggccaaagagaagggcatgaatcgggatgatcgg
atccatggagccttgctgatccttaacgagctggtccgaatcagcagcatggagggagag
cgtctgagagaagaaatggaagaaatcacacagcagcagctggtacatgacaagtactgc
aaagacctcatgggcttcggaacaaaacctcgtcacattacccccttcaccagcttccag
gctgtacagccccagcagtcaaatgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggatttggggcctcccccagcccagctaagtccaccctggtggagagccgg
tgttgcagagacttgatggaggagaaatttgatcaggtatgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gcattccgaccttctgccttcacagatactcagtacctccaagatactatgaaccatgtc
ctaagctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctggggctgctt
tctgtggctgtgaggtctgagtttaaggtctatttgcctcgcgtgctggacatcatccga
gcggccctgcccccaaaggacttcgcccataagaggcagaaggcaatgcaggtggacgcc
acagtcttcacttgcatcagcatgctggctcgagcaatggggccaagcatccagcaggat
atcaaggagctgctggagcccatgctggcagtaggactaagccctgccctcactgcagtg
ctctatgacctgagtcgtcagattccacagctaaagaaggacattcaagatgggctactg
aaaatgctgtccctggtccttatgcacaaaccactccgccacccaggcatgcccaagggc
ctggcccatcagctggcctctcctggcctcacaaccctccctgaggccagcgatgtgggc
agcatcactcttgccctccgaacgcttggcagctttgaatttgaaggccactctctgacc
caatttgttcgccactgtgcggatcattttctaaacagtgagcacaaggagatccgcatg
gaggctgcccgtacctgttcccgcctgctcacgccctccatccacctcatcagtggccat
gctcatgtggttagccagactgcagtgcaagtggtggcagacgtgcttagcaaactgctc
gtggttgggataacagatcctgaccctgacattcgctattgtgtcttggcatccctggac
gagcgctttgatgcacacctggcccaggcggagaacttgcaggccttgtttgtggctctg
aatgaccaggtgtttgagatccgggagctggccatctgcactgtgggccgactcagtagc
atgaacccggcgtttgtcatgcctttcctgcgcaagatgctcatccagattttgacagag
ctggagcacagtgggattggaagaatcaaagagcagagtgcccgcatgctggggcaccta
gtctccaatgcgccccgactcatccgtccctacatggagcctattctgaaggcattaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcctggca
acaataggagaattggcacaggttagtggcctggaaatgaggaaatgggttgatgaactt
tttattatcattatggacatgctccaggattcctctttgttggccaaaaggcaggtggct
ctatggaccctgggacagttggtggccagcactggctatgtagtagagccctacaggaag
taccctactttgcttgaggtgctactgaattttctgaagactgagcagaaccagggtaca
cgcagagaggccatccgtgtattagggcttttaggggctttggatccctacaagcacaaa
gtgaacattggcatgatagaccagtcccgggatgcctctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactatagcactagtgaaatgctggttaacatgggaaac
ctgcctctggatgagttctacccagctgtgtccatggtggccctgatgcggatcttccga
gaccagtcactctctcaccatcacaccatggttgtccaggccatcaccttcatcttcaag
tccctgggactcaaatgtgtgcagttcctgccccaggtcatgcccacgttccttaatgtc
attcgagtctgtgatggggccatccgggaatttttgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttatatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaatacctcaattcagagcacgatcattcttctcattgagcaaattgtg
gtagctcttgggggtgaatttaagctttacctgccccagctgatcccacacatgttgcgt
gtcttcatgcatgacaacagcccaggccgcatcgtctctatcaagttattggctgcaatc
cagctgtttggcgccaacctggatgactacctacatttactgctgcctcctattgtgaag
ttgtttgatgcccctgaagctccactgccatctcgaaaggcagcgctagagactgtggac
cgcctgacggagtccctggatttcactgactatgcctcccggatcattcaccctattgtt
cgaacactggaccagagcccagaactgcgctccacagccatggacacgctgtcttcactt
gtttttcaactggggaagaagtaccaaattttcattccaatggtgaataaagttctggtg
cgacaccgaatcaatcatcagcgctatgatgtgctcatctgcagaattgtcaagggatac
acacttgctgatgaagaggaggatcctttgatttaccagcatcgaatgcttaggagtggc
caaggggatgcattggctagtggaccagtggaaacaggacccatgaagaaactgcacgtc
agcaccatcaacctccaaaaggcctggggtgctgccaggagggtctccaaagatgactgg
ctggaatggctgagacggctgagcctggagctgctgaaggactcatcatcgccctccctg
cgctcctgctgggccctggcacaggcctacaacccgatggccagggatctcttcaatgct
gcgtttgtgtcctgctggtctgaattgaatgaagatcaacaggatgagctcatcagaagc
atcgagttggccctcacctcacaagacatcgctgaagtcacacaaaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccactgagagatgacaatggcatt
gttctgctgggtgaaagagctgccaagtgccgagcatatgccaaagcactacactacaaa
gaactggagttccagaaaggccccacccctgccattctagaatctctcatcagcattaat
aataagctacagcagccggaggcagcggccggagtgttagaatatgccatgaaacacttt
ggagagctggagatccaggctacctggtatgagaaactgcatgagtgggaggatgccctg
gtggcctatgacaagaaaatggacaccaacaaggatgacccagagctgatgctgggccgc
atgcgctgcctcgaggccctgggggaatggggtcagctccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagctgca
tggggtttaggtcagtgggacagcatggaagaatacacctgtatgatccctcgggacacc
catgatggggcattttatagagctgtgctggcactgcatcaggacctcttctccttggca
caacagtgcattgacaaggccagggacctgctggatgctgaattaactgcgatggcagga
gagagttacagtcgggcatatggggccatggtttcttgccacatgctgtccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgagagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtatcgtagaggactggcagaaaatccttatggtgcgg
tcccttgtggtcagccctcatgaagacatgagaacctggctcaagtacgcaagcctgtgt
ggcaagagtggcagactggctcttgctcataaaaccttagtgttgctcctgggagttgat
ccatctcggcaacttgaccatcccctgccgacagttcaccctcaggtgacctatgcctac
atgaaaaacatgtggaagagcgcccgcaagatcgatgccttccagcacatgcagcatttt
gtccagaccatgcagcaacaggcccagcatgccatcgctactgaggaccagcagcataag
caggaactgcacaagctcatggcccgatgcttcctgaaacttggagagtggcagctgaat
ctacagggcatcaacgagagcacaatccccaaagtgctgcagtactacagcgctgccacc
gagcacgaccgcagctggtacaaggcctggcacgcgtgggcagtgatgaacttcgaagct
gtgctacactacaaacatcagaaccaagcccgcgacgagaagaagaaactgcgtcatgcc
agcggggctaatatcaccaacaccaccactgccgccaccacggccgctactgccaccacc
accgccagcaccgagggcagcaacagtgagagcgaggccgagagcaccgagaacagcccc
accccatcgccgctgcagaagaaggtcactgaggatctgtccaaaaccctcctgatgtac
acggtgcctgccgtccagggcttcttccgttccatctcgttgtcacgaggcaacaacctc
caggatacactcagagttctcaccttatggtttgattatggtcactggccagatgtcaat
gaggccttagtggaaggagtgaaagccatccagattgatacctggctacaggttatacct
cagctcattgcaagaattgatactcccagacccttggtgggacgtctcattcaccagctt
ctcacagacattggtcggtaccacccccaggccctcatctaccccctaacagtggcttct
aagtccaccacgacagcccggcacaacgcagccaacaagattctgaagaacatgtgtgag
cacagcaacaccctggtccagcaggccatgatggtgagcgaggagctgatccgagtggcc
atcctgtggcatgagatgtggcacgaaggcctggaagaggcatctcgtttgtactttggg
gagaggaacgtgaaaggcatgtttgaggtgctggagcccttgcatgctatgatggaacgg
ggcccccagactctgaaggagacatcctttaatcaggcctatggtcgagatttaatggag
gcccaagagtggtgcaggaagtacatgaaatcagggaatgtcaaggacctcactcaagcc
tgggacctctattatcatgtgttccgacgaatctcaaagcagctgcctcagctcacatcc
ttagagctgcaatatgtttccccaaaacttctgatgtgccgggaccttgaattggctgtg
ccaggaacatatgaccccaaccagccaatcattcgcattcagtccatagcaccgtctttg
caagtcatcacatccaagcagaggccccggaaattgacacttatgggcagcaacgggcat
gaatttgttttccttctaaaaggccatgaagatctgcgccaggatgagcgtgtgatgcag
ctcttcggcctggttaacacccttctggccaatgacccaacatctcttcggaaaaacctc
agcatccagagatatgccgtcatccctttatcgaccaactcgggcctcattggctgggtg
ccccattgtgacacactgcacgccctcatccgggactacagggagaagaagaagatcctt
ctcaacatcgagcatcgcatcatgttgcggatggctccagactatgaccacttgactctg
atgcagaaggtggaggtgtttgagcatgccgtcaataatacagctggggacgacctggcc
aagctgctgtggctgaaaagccccagctctgaggtgtggtttgaccgaagaaccaattat
acccgttctttagcggtcatgtcaatggttgggtatattttaggcctgggagatagacac
ccatccaacctgatgctggaccgtctgagtgggaagatcctgcacattgactttggggac
tgctttgaggttgctatgacccgagagaagtttccagagaagattccatttagactaaca
agaatgttgaccaatgctatggaggttacaggcctggatggcaactacagaatcacatgc
cacacagtgatggaggtgctgcgggagcacaaggacagtgtcatggctgtgctggaagcc
tttgtctatgaccccttgctgaactggaggctgatggacacaaataccaaaggcaacaag
cgatcccgaacgaggacggattcctactctgccggccagtcagtcgaaattttggacggt
gtggaacttggggagccagcccataagaaaacggggaccacagtgccagaatctattcat
tctttcattggagacggtttggtgaaaccagaggccctaaataagaaagctattcagatt
attaacagggttcgagataagctcactggtcgggacttctctcatgatgacactttggat
gttccaacgcaagttgagctgctcatcaaacaagcgacatcccatgaaaacctctgccag
tgctatattggctggtgccctttctggtaa

DBGET integrated database retrieval system