KEGG   Macaca mulatta (rhesus monkey): 106993736
Entry
106993736         CDS       T01028                                 

Gene name
IFNE
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04622  RIG-I-like receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106993736 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106993736 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    106993736 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    106993736 (IFNE)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   106993736 (IFNE)
SSDB
Motif
Pfam: Interferon DUF1027
Other DBs
NCBI-GeneID: 106993736
NCBI-ProteinID: XP_014973103
Ensembl: ENSMMUG00000046871
LinkDB
Position
15
AA seq 193 aa
MIIKHFFEIMLVLLASTTVFFLDLKLILFQQKRVNQESLKLLNKLQTSSIHLCLPHRKNF
LLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHMEKFLIQLHQQLEYL
EALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSSCAWAIVQVEINRCLFFVF
SLTEKLSKQGTDP
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattatcaagcacttctttgaaattatgttggtgctgctggcctctaccactgtcttc
tttctagatttgaaactgattctcttccagcaaaaaagagtgaatcaagaaagtttaaaa
ctcttgaataagttgcaaacctcatcaattcacctatgtctaccacacaggaaaaacttt
ctgcttcctcagaagtctttgagtcctcagcagtaccaaaaaggacatactctggccatt
ctccatgagatgcttcagcagatcttcagcctcttcagggcaaatatttctctggatggt
tgggaggaaaatcacatggagaaattcctaattcaacttcatcaacagctagaataccta
gaagcactcatgggactggaagcagagaagctaagtggtactttgggtagtgataacctt
agattacaagttaaaatgtacttccgaaggatccatgattacctggaaaaccaggactac
agcagctgtgcctgggccattgtccaagtagaaatcaaccgatgtcttttctttgtgttc
agtctcacagaaaagctgagcaaacaaggaacagacccttga

DBGET integrated database retrieval system