KEGG   Macaca mulatta (rhesus monkey): 106995138
Entry
106995138         CDS       T01028                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106995138 (IL3RA)
   04151 PI3K-Akt signaling pathway
    106995138 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106995138 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106995138 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    106995138 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106995138 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    106995138 (IL3RA)
   04090 CD molecules [BR:mcc04090]
    106995138 (IL3RA)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL3 receptor family
   106995138 (IL3RA)
CD molecules [BR:mcc04090]
 Proteins
  106995138 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind Gemini_mov CRAM_rpt
Other DBs
NCBI-GeneID: 106995138
NCBI-ProteinID: XP_028698793
LinkDB
Position
Unknown
AA seq 378 aa
MTLLWLTLLLVATPCLLQTKEDPKAPIRNLRMKEKAQQLMWDLNRNVTDVECIKGTDYSM
PAMNNSYCQFGAISLCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFL
SCSWVVGPAAPADVQYDLYLNNPNSHEQYRCLHYKTDARGTQIGCRFDDIARLSRGSQSS
HILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFRYEL
RIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDQEEGAS
SRAWRTSLLIALGTLLALLCVFLLCRRYLVMQRLFPRIPHMKDPIGDTFQQDKLVVWEAG
KAGLEECLVSEVQVVEKT
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgaccctcctttggctgacgctgctcctggtcgccacgccctgtctcctgcaaaccaag
gaggatccaaaggcaccaatcaggaatctaaggatgaaagaaaaggctcagcagttgatg
tgggacctgaacagaaacgtgaccgacgtggagtgtatcaaaggcaccgactattctatg
ccggcaatgaacaacagctattgccagttcggagccatttccttatgtgaagtgaccaac
tacaccgtccgagtggccagtcccccgttctccacgtggatcctcttccctgagaacagt
gggacgcctcgggcaggcgcggagaatctgacctgctgggttcatgacgtggatttcttg
agctgcagctgggtggtaggcccggcggcccccgctgacgtccagtacgacctgtacttg
aacaatcccaacagccacgaacagtacaggtgccttcactacaaaacggatgctcgggga
acacagatcgggtgtcggttcgatgacatcgctcgactctcccgcggttctcaaagttcc
cacatcctggtgaggggcaggagcgcagccgtcagtatcccctgcacagataagtttgtc
ttcttttcacagattgagagattaactccacccaacatgactggagagtgtaatgagaca
cattccttcatgcactggaaaatgaaaagtcatttcaatcgcaaattccgctatgagctt
cggatccaaaagagaatgcagcctgtaaggacagaacaggtcagagacacaacctccttc
cagctacccaatcctggaacgtacacagtgcaaataagagcccgggaaacagtgtatgaa
ttcttgagtgcctggagcaccccccagcgcttcgagtgcgaccaggaggagggcgcgagc
tcgcgtgcctggcggacgtcgctgctgatcgcgctggggacgctgctggccttgctctgt
gtgttcctcctctgcagaaggtatctggtgatgcagaggctgtttccccgcatcccacac
atgaaagaccccatcggtgacaccttccaacaggacaagctggtggtctgggaggcgggc
aaagccggcctggaggagtgtctggtgtctgaagtgcaggtggtggagaaaacttga

DBGET integrated database retrieval system