KEGG   Macaca mulatta (rhesus monkey): 106996003
Entry
106996003         CDS       T01028                                 

Definition
(RefSeq) immunoglobulin heavy variable 4-38-2
  KO
K06856  immunoglobulin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04672  Intestinal immune network for IgA production
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05150  Staphylococcus aureus infection
mcc05152  Tuberculosis
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05202  Transcriptional misregulation in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05340  Primary immunodeficiency
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    106996003
   04020 Calcium signaling pathway
    106996003
   04072 Phospholipase D signaling pathway
    106996003
   04151 PI3K-Akt signaling pathway
    106996003
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    106996003
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    106996003
   04613 Neutrophil extracellular trap formation
    106996003
   04650 Natural killer cell mediated cytotoxicity
    106996003
   04662 B cell receptor signaling pathway
    106996003
   04664 Fc epsilon RI signaling pathway
    106996003
   04666 Fc gamma R-mediated phagocytosis
    106996003
   04672 Intestinal immune network for IgA production
    106996003
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    106996003
  09163 Immune disease
   05310 Asthma
    106996003
   05322 Systemic lupus erythematosus
    106996003
   05323 Rheumatoid arthritis
    106996003
   05320 Autoimmune thyroid disease
    106996003
   05330 Allograft rejection
    106996003
   05340 Primary immunodeficiency
    106996003
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    106996003
   05416 Viral myocarditis
    106996003
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    106996003
   05150 Staphylococcus aureus infection
    106996003
   05152 Tuberculosis
    106996003
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    106996003
   05169 Epstein-Barr virus infection
    106996003
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    106996003
   05140 Leishmaniasis
    106996003
   05143 African trypanosomiasis
    106996003
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    106996003
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    106996003
SSDB
Motif
Pfam: V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 106996003
NCBI-ProteinID: XP_028707838
LinkDB
Position
7
AA seq 166 aa
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGGSISGYYYWSWIRQP
PGKGLEWIGGIYGNSASTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCARHT
VRGGGCEPRHKPPCREAEGAGADVALVVKFQQFREAKDTSISSFLL
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaagcacctgtggttcttcctcctcctggtggcagctcccagatgggtcctgtcccag
gtgcagctgcaggagtcgggcccaggactggtgaagccttcggagaccctgtccctcacc
tgcactgtctctggtggctccatcagcggttactactactggagctggatccgccagccc
ccagggaagggactggagtggattgggggtatctatggtaatagtgcgagcacctactac
aacccctccctcaagagtcgagtcaccatttcaaaagacacgtccaagaaccagttctcc
ctgaagctgagctctgtgaccgccgcggacacggccgtgtattactgtgcgagacacaca
gtgaggggaggtgggtgtgagcccagacacaaacctccctgcagggaggcggagggggcg
ggcgcagacgtggccttggtcgtcaagtttcagcaattccgagaagccaaggacacctcc
atctcctccttcctgctctga

KEGG   Macaca mulatta (rhesus monkey): 106999628
Entry
106999628         CDS       T01028                                 

Definition
(RefSeq) immunoglobulin heavy variable 4-4
  KO
K06856  immunoglobulin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04672  Intestinal immune network for IgA production
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05150  Staphylococcus aureus infection
mcc05152  Tuberculosis
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05202  Transcriptional misregulation in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05340  Primary immunodeficiency
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    106999628
   04020 Calcium signaling pathway
    106999628
   04072 Phospholipase D signaling pathway
    106999628
   04151 PI3K-Akt signaling pathway
    106999628
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    106999628
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    106999628
   04613 Neutrophil extracellular trap formation
    106999628
   04650 Natural killer cell mediated cytotoxicity
    106999628
   04662 B cell receptor signaling pathway
    106999628
   04664 Fc epsilon RI signaling pathway
    106999628
   04666 Fc gamma R-mediated phagocytosis
    106999628
   04672 Intestinal immune network for IgA production
    106999628
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    106999628
  09163 Immune disease
   05310 Asthma
    106999628
   05322 Systemic lupus erythematosus
    106999628
   05323 Rheumatoid arthritis
    106999628
   05320 Autoimmune thyroid disease
    106999628
   05330 Allograft rejection
    106999628
   05340 Primary immunodeficiency
    106999628
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    106999628
   05416 Viral myocarditis
    106999628
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    106999628
   05150 Staphylococcus aureus infection
    106999628
   05152 Tuberculosis
    106999628
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    106999628
   05169 Epstein-Barr virus infection
    106999628
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    106999628
   05140 Leishmaniasis
    106999628
   05143 African trypanosomiasis
    106999628
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    106999628
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    106999628
SSDB
Motif
Pfam: V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 106999628
NCBI-ProteinID: XP_015000136
LinkDB
Position
7
AA seq 215 aa
MKHLWFFFLLVAAPRWVLSQVQLQESGPAVVKPSETLSLTCAVSGGSISSSNWWSWIRQS
PGKGLEWIGGIYGSGGSTEYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCARDT
VRGGGCEPRHKPPCREAEGAGAGAAQDQQGARGAHRAGGRVRSRCREGGASSSAQCSPSS
PAPQLSPGLLLIYYLWFCFLTFFCQKRKEEGTFSS
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaagcacctgtggttcttcttcctcctggtggcagctcccagatgggtcctgtcccag
gtgcagctgcaggagtcgggcccagcagtggtgaagccttcggagaccctgtccctcacc
tgcgctgtctctggtggctccatcagcagtagtaactggtggagctggatccgccagtcc
ccagggaaggggctggaatggattgggggtatctatggtagtggtgggagcaccgaatac
aacccctccctcaagagtcgagtcaccatttcaaaagacacgtccaagaaccagttctcc
ctgaagctgagctctgtgaccgccgcggacaccgccgtgtattactgtgcgagagacaca
gtgaggggaggtgggtgtgagcccagacacaaacctccctgcagggaggcggagggggcg
ggcgcaggtgccgctcaggaccagcagggggcgcgcggggcccacagagcaggaggccgg
gtcaggagcaggtgcagggagggcggggcttcctcatctgctcagtgctctccctcctca
ccagcacctcagctgtccccagggctcctccttatttattatctgtggttctgcttcctc
acattcttctgccagaaaagaaaggaggaaggcacattttcctcttag

KEGG   Macaca mulatta (rhesus monkey): 114675805
Entry
114675805         CDS       T01028                                 

Definition
(RefSeq) uncharacterized protein LOC114675805
  KO
K06856  immunoglobulin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04672  Intestinal immune network for IgA production
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05150  Staphylococcus aureus infection
mcc05152  Tuberculosis
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05202  Transcriptional misregulation in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05340  Primary immunodeficiency
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    114675805
   04020 Calcium signaling pathway
    114675805
   04072 Phospholipase D signaling pathway
    114675805
   04151 PI3K-Akt signaling pathway
    114675805
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    114675805
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    114675805
   04613 Neutrophil extracellular trap formation
    114675805
   04650 Natural killer cell mediated cytotoxicity
    114675805
   04662 B cell receptor signaling pathway
    114675805
   04664 Fc epsilon RI signaling pathway
    114675805
   04666 Fc gamma R-mediated phagocytosis
    114675805
   04672 Intestinal immune network for IgA production
    114675805
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    114675805
  09163 Immune disease
   05310 Asthma
    114675805
   05322 Systemic lupus erythematosus
    114675805
   05323 Rheumatoid arthritis
    114675805
   05320 Autoimmune thyroid disease
    114675805
   05330 Allograft rejection
    114675805
   05340 Primary immunodeficiency
    114675805
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    114675805
   05416 Viral myocarditis
    114675805
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    114675805
   05150 Staphylococcus aureus infection
    114675805
   05152 Tuberculosis
    114675805
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    114675805
   05169 Epstein-Barr virus infection
    114675805
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    114675805
   05140 Leishmaniasis
    114675805
   05143 African trypanosomiasis
    114675805
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    114675805
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    114675805
SSDB
Motif
Pfam: V-set
Other DBs
NCBI-GeneID: 114675805
NCBI-ProteinID: XP_028698723
LinkDB
Position
Unknown
AA seq 269 aa
MDRTWRILFLVAVGTGAHSQVKLVESGAEVKKPGSSVKVSWKASRYTFTSYVMHWVRQNL
GQGLEWMGFYVHTVGSALIWASLLITLNISGLYESGPAVAAPHGAVLSLFSLFAEDLCEV
PWWSLRWKNFDSTGAHRTQNLMSPTCSEWGFSIERSCCSSSSVNTTGEQCEVHLVESGGG
LAKPEESLRLSYAASAGFTFSSYYMNCVRQAPGNRLEWVRQVNPNGGSTYLTDSGKGRFT
IPRDNAKNTLHLQMNRLKTENTAMYYCTQ
NT seq 810 nt   +upstreamnt  +downstreamnt
atggaccggacctggaggatcctcttcttggtggcagtaggtacaggtgcccactcccag
gtgaagctggtggagtctggggcagaggtgaagaagcctgggtcctcagtgaaggtctcc
tggaaggcttccagatacacctttaccagctatgttatgcactgggtgcgacagaatctt
ggacaagggcttgagtggatgggattttatgtccacaccgtggggtctgcactgatctgg
gcttccctcctcatcaccctcaatattagtggcctttatgaatcaggtccagctgtggct
gctccacatggggctgttctcagtctgttctctctgtttgcagaagacctgtgtgaagtt
ccctggtggagtctgaggtggaaaaattttgattctaccggtgcccacaggacacaaaat
ttaatgtctcccacatgtagtgaatggggattcagcattgaaaggagctgctgttcttcc
tcctcagtcaacaccacaggagagcagtgtgaggtgcacctggtggagtccgggggaggc
ttggcaaaacctgaggagtccctgagactctcctatgcagcctctgcaggattcaccttc
agtagctactacatgaactgtgtccgccaggctccagggaataggctggagtgggttaga
caagttaatcctaatgggggtagcacatacctcacagactccgggaagggccgattcacc
atccccagagataacgccaagaacacacttcatctgcaaatgaacaggctgaaaaccgag
aacacagccatgtattactgtacacagtga

KEGG   Macaca mulatta (rhesus monkey): 114679736
Entry
114679736         CDS       T01028                                 

Definition
(RefSeq) uncharacterized protein LOC114679736
  KO
K06856  immunoglobulin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04672  Intestinal immune network for IgA production
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05150  Staphylococcus aureus infection
mcc05152  Tuberculosis
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05202  Transcriptional misregulation in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05340  Primary immunodeficiency
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    114679736
   04020 Calcium signaling pathway
    114679736
   04072 Phospholipase D signaling pathway
    114679736
   04151 PI3K-Akt signaling pathway
    114679736
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    114679736
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    114679736
   04613 Neutrophil extracellular trap formation
    114679736
   04650 Natural killer cell mediated cytotoxicity
    114679736
   04662 B cell receptor signaling pathway
    114679736
   04664 Fc epsilon RI signaling pathway
    114679736
   04666 Fc gamma R-mediated phagocytosis
    114679736
   04672 Intestinal immune network for IgA production
    114679736
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    114679736
  09163 Immune disease
   05310 Asthma
    114679736
   05322 Systemic lupus erythematosus
    114679736
   05323 Rheumatoid arthritis
    114679736
   05320 Autoimmune thyroid disease
    114679736
   05330 Allograft rejection
    114679736
   05340 Primary immunodeficiency
    114679736
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    114679736
   05416 Viral myocarditis
    114679736
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    114679736
   05150 Staphylococcus aureus infection
    114679736
   05152 Tuberculosis
    114679736
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    114679736
   05169 Epstein-Barr virus infection
    114679736
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    114679736
   05140 Leishmaniasis
    114679736
   05143 African trypanosomiasis
    114679736
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    114679736
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    114679736
SSDB
Motif
Pfam: V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 114679736
NCBI-ProteinID: XP_028707927
LinkDB
Position
7
AA seq 261 aa
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSNYWSWIRQPP
GKGLEWIGRIYGSGGSTDYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCARDTV
RGGGCEPRHKPPCREAEGAGAGAAQDQQGARGAHRAGGRVRSRCREGGASSSAQCSPSSP
APQLSQGSSFFDICGSASSHSSARKERRKAHFPLTIEISPITRNFPTSSCMAHYCLVINN
IYILMLLTISWFMSSIELCPL
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaagcacctgtggttcttcctcctgctggtggcagctcccagatgggtcctgtcccag
gtgcagctgcaggagtcgggcccaggactggtgaagccttcggagaccctgtccctcacc
tgcgctgtctctggtggctccatcagcagtaactactggagctggatccgccagccccca
gggaaggggctggagtggattggacgtatctatggtagtggtgggagcaccgactacaac
ccctccctcaagagtcgagtcaccatttcaacagacacgtccaagaaccagttctccctg
aagctgagctctgtgaccgccgcggacacggccgtgtattactgtgcgagagacacagtg
aggggaggtgggtgtgagcccagacacaaacctccctgcagggaggcggagggggcgggc
gcaggtgccgctcaggaccagcagggggcgcgcggggcccacagagcaggaggccgggtc
aggagcaggtgcagggagggcggggcttcctcatctgctcagtgctctccctcctcacca
gcacctcagctgtcccagggctcctctttctttgatatctgtggttctgcttcctcacat
tcttctgccagaaaagaaaggaggaaggcacattttcctcttacaattgagatttcaccg
attactaggaactttcctacaagttcctgcatggcccattattgcttagtgattaataat
atatatattctaatgcttctcaccatctcttggtttatgtcatcaatcgaattgtgccct
ctttga

KEGG   Macaca mulatta (rhesus monkey): 714419
Entry
714419            CDS       T01028                                 

Definition
(RefSeq) uncharacterized protein LOC714419
  KO
K06856  immunoglobulin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04672  Intestinal immune network for IgA production
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05150  Staphylococcus aureus infection
mcc05152  Tuberculosis
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05202  Transcriptional misregulation in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05340  Primary immunodeficiency
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    714419
   04020 Calcium signaling pathway
    714419
   04072 Phospholipase D signaling pathway
    714419
   04151 PI3K-Akt signaling pathway
    714419
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    714419
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    714419
   04613 Neutrophil extracellular trap formation
    714419
   04650 Natural killer cell mediated cytotoxicity
    714419
   04662 B cell receptor signaling pathway
    714419
   04664 Fc epsilon RI signaling pathway
    714419
   04666 Fc gamma R-mediated phagocytosis
    714419
   04672 Intestinal immune network for IgA production
    714419
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    714419
  09163 Immune disease
   05310 Asthma
    714419
   05322 Systemic lupus erythematosus
    714419
   05323 Rheumatoid arthritis
    714419
   05320 Autoimmune thyroid disease
    714419
   05330 Allograft rejection
    714419
   05340 Primary immunodeficiency
    714419
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    714419
   05416 Viral myocarditis
    714419
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    714419
   05150 Staphylococcus aureus infection
    714419
   05152 Tuberculosis
    714419
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    714419
   05169 Epstein-Barr virus infection
    714419
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    714419
   05140 Leishmaniasis
    714419
   05143 African trypanosomiasis
    714419
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    714419
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    714419
SSDB
Motif
Pfam: V-set Ig_3 DUF4426
Other DBs
NCBI-GeneID: 714419
NCBI-ProteinID: XP_028707830
LinkDB
Position
7
AA seq 246 aa
MELGLSWVFLVAILEGVQCEVQLVESGGGLVQPGRSLRPSCAASGFTFSSYGMHWVRQAP
EEGLVWVSYIGSSTMYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAQVTLKE
SDPALVKPTQTLTLTCTFSGFSLSTSGMGVDGIRQPPGKALEWLARIDWDDDKYYSPSLK
SRLTISKDTSKNQVVLTMTNMDPVDTATYYCARRPQRHSSGRLLYKNPGCFLLVLPPHQC
RTGKCG
NT seq 741 nt   +upstreamnt  +downstreamnt
atggagttggggctgagctgggttttccttgttgctattttagaaggtgtccagtgtgag
gtgcagctggtggagtctgggggaggcttggtacagcctggccggtccctgagaccctcc
tgtgcagcctctggattcactttcagtagctatggcatgcactgggtccgccaggctccg
gaagaggggctggtgtgggtttcatacattggtagtagtaccatgtactacgcagactcc
gtgaagggccgattcaccatctccagagacaatgccaagaactcgctgtatctgcaaatg
aacagcctgagagccgaggacacggctgtgtattactgtgcccaggtcaccttgaaggag
tctgatcctgcgctagtgaaacccacacagaccctcacgctgacctgcaccttctctggg
ttctcactcagcacttctggaatgggtgtggacgggatccgtcagcccccagggaaggcc
ctggagtggcttgcacgcattgattgggatgatgataaatactacagcccatcgctgaag
agcaggctcaccatctccaaggacacctccaagaaccaggttgtccttacaatgaccaac
atggaccctgtggacacagccacatattactgtgcacggagaccacagagacacagctca
gggcgcctcctgtacaagaacccaggctgcttcttattggtgctccctccccaccaatgc
agaacaggaaagtgcggctga

KEGG   Macaca mulatta (rhesus monkey): 720452
Entry
720452            CDS       T01028                                 

Definition
(RefSeq) Ig heavy chain V region MOPC 315 isoform X1
  KO
K06856  immunoglobulin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04672  Intestinal immune network for IgA production
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05150  Staphylococcus aureus infection
mcc05152  Tuberculosis
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05202  Transcriptional misregulation in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05340  Primary immunodeficiency
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    720452
   04020 Calcium signaling pathway
    720452
   04072 Phospholipase D signaling pathway
    720452
   04151 PI3K-Akt signaling pathway
    720452
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    720452
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    720452
   04613 Neutrophil extracellular trap formation
    720452
   04650 Natural killer cell mediated cytotoxicity
    720452
   04662 B cell receptor signaling pathway
    720452
   04664 Fc epsilon RI signaling pathway
    720452
   04666 Fc gamma R-mediated phagocytosis
    720452
   04672 Intestinal immune network for IgA production
    720452
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    720452
  09163 Immune disease
   05310 Asthma
    720452
   05322 Systemic lupus erythematosus
    720452
   05323 Rheumatoid arthritis
    720452
   05320 Autoimmune thyroid disease
    720452
   05330 Allograft rejection
    720452
   05340 Primary immunodeficiency
    720452
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    720452
   05416 Viral myocarditis
    720452
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    720452
   05150 Staphylococcus aureus infection
    720452
   05152 Tuberculosis
    720452
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    720452
   05169 Epstein-Barr virus infection
    720452
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    720452
   05140 Leishmaniasis
    720452
   05143 African trypanosomiasis
    720452
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    720452
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    720452
SSDB
Motif
Pfam: V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 720452
NCBI-ProteinID: XP_028707919
LinkDB
Position
7
AA seq 236 aa
MKHLWFFLLLVVAPRWVLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGYYWSWIRQPP
GKGLEWIGYIGGSSGSTYYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCARKGS
KDESRAFPLETPGQGHSHCRNLTARQGWAGGGTQEPPSTGSNPRAGVQKDGEEVSSQGLC
LPLSTTTTTTTKLSVQPAADVPLNILLHRNHSYNLRQRELFLKCVSRTINILIVMI
NT seq 711 nt   +upstreamnt  +downstreamnt
atgaagcacctgtggttcttcctcctcctggtggtagctcccagatgggtcctgtcccag
gtgcagctgcaggagtcgggcccaggactggtgaagccttcggagaccctgtccctcacc
tgcgctgtctctggtggctccatcagcggttactactggagctggatccgccaaccccca
gggaaggggctggagtggattgggtatatcggtggtagtagtgggagcacctactacaac
ccctccctcaagagtcgagtcaccatttcaacagacacgtccaagaaccagttctccctg
aagctgagctctgtgaccgccgcggacacggccgtgtattactgtgcgagaaaagggagt
aaagatgaaagtagagcttttcccctggagacgcctggtcaaggtcacagccactgcaga
aacctcactgcaaggcaaggctgggctggagggggcactcaggagccaccaagcacaggt
tccaaccccagagcaggtgtacagaaggatggggaggaagtttcctctcagggcctgtgt
cttcctttgtcaacaacaacaacaacaacaacaaaactaagtgttcaaccagctgctgat
gtgcctttaaatattctgttacatcggaaccattcatataacttaaggcaacgagaacta
tttttaaagtgtgtttctaggacaataaatatcttaatagtgatgatataa

KEGG   Macaca mulatta (rhesus monkey): 720904
Entry
720904            CDS       T01028                                 

Definition
(RefSeq) immunoglobulin heavy variable 4-59 isoform X1
  KO
K06856  immunoglobulin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04672  Intestinal immune network for IgA production
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05150  Staphylococcus aureus infection
mcc05152  Tuberculosis
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05202  Transcriptional misregulation in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05340  Primary immunodeficiency
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    720904
   04020 Calcium signaling pathway
    720904
   04072 Phospholipase D signaling pathway
    720904
   04151 PI3K-Akt signaling pathway
    720904
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    720904
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    720904
   04613 Neutrophil extracellular trap formation
    720904
   04650 Natural killer cell mediated cytotoxicity
    720904
   04662 B cell receptor signaling pathway
    720904
   04664 Fc epsilon RI signaling pathway
    720904
   04666 Fc gamma R-mediated phagocytosis
    720904
   04672 Intestinal immune network for IgA production
    720904
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    720904
  09163 Immune disease
   05310 Asthma
    720904
   05322 Systemic lupus erythematosus
    720904
   05323 Rheumatoid arthritis
    720904
   05320 Autoimmune thyroid disease
    720904
   05330 Allograft rejection
    720904
   05340 Primary immunodeficiency
    720904
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    720904
   05416 Viral myocarditis
    720904
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    720904
   05150 Staphylococcus aureus infection
    720904
   05152 Tuberculosis
    720904
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    720904
   05169 Epstein-Barr virus infection
    720904
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    720904
   05140 Leishmaniasis
    720904
   05143 African trypanosomiasis
    720904
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    720904
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    720904
SSDB
Motif
Pfam: V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 720904
NCBI-ProteinID: XP_028707923
LinkDB
Structure
PDB: 
3Q6G

Position
7
AA seq 147 aa
MKHLWFFLLLVAAPRWVLSQLQLQESGPGLVKPSETLSLTCAVSGGSISSNYWSWIRQPP
GKGLEWIGRISGSGGSTDYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCARDTG
MVLAHLLPGAGRFLLSVVYLLLLPALK
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaagcacctgtggttcttcctcctcctggtggcagctcccagatgggtcctgtcccag
ctgcagctgcaggagtcgggcccaggactggtgaagccttcggagaccctgtccctcacc
tgcgctgtctctggtggctccatcagcagtaactactggagctggatccgccagccccca
gggaagggactggagtggattggacgtatctctggtagtggtgggagcaccgactacaac
ccctccctcaagagtcgagtcaccatttcaacagacacgtccaagaaccagttctccctg
aagctgagctctgtgaccgccgcggacacggccgtgtattactgtgcgagagacacaggg
atggtcttagcgcacctgcttcctggggcagggcgcttccttctctcagttgtgtacttg
ctccttctgccagctctgaagtga

KEGG   Macaca mulatta (rhesus monkey): 720935
Entry
720935            CDS       T01028                                 

Definition
(RefSeq) immunoglobulin heavy variable 4-61
  KO
K06856  immunoglobulin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04672  Intestinal immune network for IgA production
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05150  Staphylococcus aureus infection
mcc05152  Tuberculosis
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05202  Transcriptional misregulation in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05340  Primary immunodeficiency
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    720935
   04020 Calcium signaling pathway
    720935
   04072 Phospholipase D signaling pathway
    720935
   04151 PI3K-Akt signaling pathway
    720935
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    720935
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    720935
   04613 Neutrophil extracellular trap formation
    720935
   04650 Natural killer cell mediated cytotoxicity
    720935
   04662 B cell receptor signaling pathway
    720935
   04664 Fc epsilon RI signaling pathway
    720935
   04666 Fc gamma R-mediated phagocytosis
    720935
   04672 Intestinal immune network for IgA production
    720935
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    720935
  09163 Immune disease
   05310 Asthma
    720935
   05322 Systemic lupus erythematosus
    720935
   05323 Rheumatoid arthritis
    720935
   05320 Autoimmune thyroid disease
    720935
   05330 Allograft rejection
    720935
   05340 Primary immunodeficiency
    720935
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    720935
   05416 Viral myocarditis
    720935
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    720935
   05150 Staphylococcus aureus infection
    720935
   05152 Tuberculosis
    720935
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    720935
   05169 Epstein-Barr virus infection
    720935
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    720935
   05140 Leishmaniasis
    720935
   05143 African trypanosomiasis
    720935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    720935
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    720935
SSDB
Motif
Pfam: V-set Ig_3 ig Inhibitor_I68
Other DBs
NCBI-GeneID: 720935
NCBI-ProteinID: XP_015000131
LinkDB
Position
7
AA seq 193 aa
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSYYYWSWIRQ
APGKGLEWIGYIYGGSGSTSYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCARH
TVRGGECEPRHKPPCREAEGAGAGAAQDQQGARGAHRAGGRVRSRCREGGASSSAQCSPS
SPAPQLSPGLLFL
NT seq 582 nt   +upstreamnt  +downstreamnt
atgaagcacctgtggttcttcctcctcctggtggcagctcccagatgggtcctgtcccag
gtgcagctgcaggagtcgggcccaggactggtgaagccttcggagaccctgtccctcacc
tgcgctgtctctggtggctctatcagcagtagttactactactggagctggatccgccag
gccccagggaagggactggagtggattgggtacatctatggtggtagtgggagcaccagc
tacaacccgtccctcaagagtcgagtcaccatttcaagagacacgtccaagaaccagttc
tccctgaagctgagctctgtgaccgccgcggacacggccgtgtattactgtgcgagacac
acagtgaggggaggtgagtgtgagcccagacacaaacctccctgcagggaggcggagggg
gcgggcgcaggtgccgctcaggaccagcagggggcgcgcggggcccacagagcaggaggc
cgggtcaggagcaggtgcagggagggcggggcttcctcatctgctcagtgctctccctcc
tcaccagcacctcagctgtccccggggctcctctttctttga

KEGG   Macaca mulatta (rhesus monkey): 720985
Entry
720985            CDS       T01028                                 

Definition
(RefSeq) immunoglobulin heavy variable 4-59
  KO
K06856  immunoglobulin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04672  Intestinal immune network for IgA production
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05150  Staphylococcus aureus infection
mcc05152  Tuberculosis
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05202  Transcriptional misregulation in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05340  Primary immunodeficiency
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    720985
   04020 Calcium signaling pathway
    720985
   04072 Phospholipase D signaling pathway
    720985
   04151 PI3K-Akt signaling pathway
    720985
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    720985
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    720985
   04613 Neutrophil extracellular trap formation
    720985
   04650 Natural killer cell mediated cytotoxicity
    720985
   04662 B cell receptor signaling pathway
    720985
   04664 Fc epsilon RI signaling pathway
    720985
   04666 Fc gamma R-mediated phagocytosis
    720985
   04672 Intestinal immune network for IgA production
    720985
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    720985
  09163 Immune disease
   05310 Asthma
    720985
   05322 Systemic lupus erythematosus
    720985
   05323 Rheumatoid arthritis
    720985
   05320 Autoimmune thyroid disease
    720985
   05330 Allograft rejection
    720985
   05340 Primary immunodeficiency
    720985
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    720985
   05416 Viral myocarditis
    720985
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    720985
   05150 Staphylococcus aureus infection
    720985
   05152 Tuberculosis
    720985
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    720985
   05169 Epstein-Barr virus infection
    720985
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    720985
   05140 Leishmaniasis
    720985
   05143 African trypanosomiasis
    720985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    720985
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    720985
SSDB
Motif
Pfam: V-set Ig_3 ig I-set DUF2093
Other DBs
NCBI-GeneID: 720985
NCBI-ProteinID: XP_015000133
LinkDB
Structure
PDB: 
5UKN

Position
7
AA seq 184 aa
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCAVSGGSISDDYYWSWIRQP
PGKGLEWIGYIYGSGGGTNYNPSLKNRVTISIDTSKNQFSLKLSSVTAADTAVYYCARDT
VRGGECEPRHKPPCREAEGAGAEPVHANNCVSQCTLGLVKPLQTLSLTCAISGFPITTSA
SCWS
NT seq 555 nt   +upstreamnt  +downstreamnt
atgaagcacctgtggttcttcctcctcctggtggcagctcccagatgggtcttgtcccag
gtgcagctgcaggagtcgggcccaggactggtgaagccttcggagaccctgtccctcacc
tgcgctgtctctggtggctccatcagcgatgattactactggagctggatccgccagccc
ccagggaagggactggagtggattgggtacatctatggtagtggtgggggcaccaactac
aatccctccctcaagaatcgagtcaccatttcaatagacacgtccaagaaccagttctcc
ctgaagctgagctctgtgaccgccgcggacacggccgtgtattactgtgcgagagacaca
gtgaggggaggtgagtgtgagcccagacacaaacctccctgcagggaggcggagggggcg
ggcgcagaacctgtgcatgccaacaactgtgtttctcagtgcactcttggcctggtgaag
cccttacagaccctctccctcacctgtgccatctctggattccccatcacaaccagtgct
tcctgctggagctga

KEGG   Macaca mulatta (rhesus monkey): 721002
Entry
721002            CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: immunoglobulin heavy variable 4-39
  KO
K06856  immunoglobulin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04672  Intestinal immune network for IgA production
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05150  Staphylococcus aureus infection
mcc05152  Tuberculosis
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05202  Transcriptional misregulation in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05340  Primary immunodeficiency
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    721002
   04020 Calcium signaling pathway
    721002
   04072 Phospholipase D signaling pathway
    721002
   04151 PI3K-Akt signaling pathway
    721002
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    721002
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    721002
   04613 Neutrophil extracellular trap formation
    721002
   04650 Natural killer cell mediated cytotoxicity
    721002
   04662 B cell receptor signaling pathway
    721002
   04664 Fc epsilon RI signaling pathway
    721002
   04666 Fc gamma R-mediated phagocytosis
    721002
   04672 Intestinal immune network for IgA production
    721002
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    721002
  09163 Immune disease
   05310 Asthma
    721002
   05322 Systemic lupus erythematosus
    721002
   05323 Rheumatoid arthritis
    721002
   05320 Autoimmune thyroid disease
    721002
   05330 Allograft rejection
    721002
   05340 Primary immunodeficiency
    721002
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    721002
   05416 Viral myocarditis
    721002
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    721002
   05150 Staphylococcus aureus infection
    721002
   05152 Tuberculosis
    721002
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    721002
   05169 Epstein-Barr virus infection
    721002
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    721002
   05140 Leishmaniasis
    721002
   05143 African trypanosomiasis
    721002
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    721002
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    721002
SSDB
Motif
Pfam: V-set Ig_3
Other DBs
NCBI-GeneID: 721002
NCBI-ProteinID: XP_015000129
LinkDB
Position
7
AA seq 229 aa
MKDVLNYNKHWMDPGLFEVTVIITFSSCFNVSEVVNDHLNDLDVWLVLYESLRVEELTLF
QNLSLIHDHIHLPDRLLQHFSYLEEEDSGLGSSSHGKCSLRVMDLLCKNMKHLWFFLLLV
AAPRWVLSQVQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEYIGYI
SGSSGSTYYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTACITVRDTQ
NT seq 690 nt   +upstreamnt  +downstreamnt
atgaaggatgttctgaactacaataaacattggatggatccaggattgtttgaagtcact
gtcattattacattcagcagttgtttcaatgtgtctgaagtagtaaatgaccatttaaat
gacctggatgtgtggttggttttatatgaatctttaagggtagaagagttgactctattc
caaaatctgtccctgatccatgatcacattcatctcccagatcggctccttcagcacttt
tcctacctggaagaagaggactctgggcttgggtccagctcacatgggaaatgctctctg
agagtcatggacctcctgtgcaagaacatgaagcacctgtggttcttcctcctcctggtg
gcagctcccagatgggtcctgtcccaggtgcagctgcaggagtcgggcccaggactggtg
aagccttcggagaccctgtccctcacctgcgctgtctctggttactccatcagcagtggt
tactactggggctggatccgtcagcccccagggaagggactggagtatattgggtatatc
agtggtagtagtgggagcacctactacaacccctccctcaagagtcgagtcaccatttca
aaagacacgtccaagaaccagttctccctgaagctgagctctgtgaccgccgcggacacg
gcctgtattactgtgcgagacacacagtga

KEGG   Macaca mulatta (rhesus monkey): 721083
Entry
721083            CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: immunoglobulin heavy variable 4-28
  KO
K06856  immunoglobulin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04672  Intestinal immune network for IgA production
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05150  Staphylococcus aureus infection
mcc05152  Tuberculosis
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05202  Transcriptional misregulation in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05340  Primary immunodeficiency
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    721083
   04020 Calcium signaling pathway
    721083
   04072 Phospholipase D signaling pathway
    721083
   04151 PI3K-Akt signaling pathway
    721083
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    721083
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    721083
   04613 Neutrophil extracellular trap formation
    721083
   04650 Natural killer cell mediated cytotoxicity
    721083
   04662 B cell receptor signaling pathway
    721083
   04664 Fc epsilon RI signaling pathway
    721083
   04666 Fc gamma R-mediated phagocytosis
    721083
   04672 Intestinal immune network for IgA production
    721083
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    721083
  09163 Immune disease
   05310 Asthma
    721083
   05322 Systemic lupus erythematosus
    721083
   05323 Rheumatoid arthritis
    721083
   05320 Autoimmune thyroid disease
    721083
   05330 Allograft rejection
    721083
   05340 Primary immunodeficiency
    721083
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    721083
   05416 Viral myocarditis
    721083
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    721083
   05150 Staphylococcus aureus infection
    721083
   05152 Tuberculosis
    721083
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    721083
   05169 Epstein-Barr virus infection
    721083
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    721083
   05140 Leishmaniasis
    721083
   05143 African trypanosomiasis
    721083
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    721083
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    721083
SSDB
Motif
Pfam: V-set Ig_3 ig DUF4961
Other DBs
NCBI-GeneID: 721083
NCBI-ProteinID: XP_028707831
Ensembl: ENSMMUG00000048495
LinkDB
Position
7
AA seq 163 aa
MITVISQTSSFSTSPYLEEEDSGLGSSSHGKCSLRVTDLLCKNMKHLWFFLLLVAAPRWV
LSQVQLQESGPGLVKPSETLSLTCAVSGGSISSSNWWSWIRQPPGKGLEWIGYISGSSGS
TYYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTACITVRDTQ
NT seq 492 nt   +upstreamnt  +downstreamnt
atgatcacagtcatctcccagacgagctccttcagcacatctccctacctggaagaagag
gactctgggcttggctccagctcacatgggaaatgttctctgagagtcacggacctcctg
tgcaagaacatgaagcacctgtggttcttcctcctcctggtggcagctcccagatgggtc
ctgtcccaggtgcagctgcaggagtcgggcccaggactggtgaagccttcggagaccctg
tccctcacatgcgctgtctctggtggctctatcagcagtagtaactggtggagctggatc
cgccagcccccagggaaagggctggagtggattgggtatatcagtggtagtagtggtagc
acctactacaacccctccctcaagagtcgagtcaccatttcaacagacacgtccaagaac
cagttctccctgaagctgagctctgtgaccgccgcggacacggcctgtattactgtgcga
gacacacagtga

KEGG   Macaca mulatta (rhesus monkey): 722278
Entry
722278            CDS       T01028                                 

Definition
(RefSeq) immunoglobulin heavy variable 4-59
  KO
K06856  immunoglobulin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04672  Intestinal immune network for IgA production
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05150  Staphylococcus aureus infection
mcc05152  Tuberculosis
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05202  Transcriptional misregulation in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05340  Primary immunodeficiency
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    722278
   04020 Calcium signaling pathway
    722278
   04072 Phospholipase D signaling pathway
    722278
   04151 PI3K-Akt signaling pathway
    722278
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    722278
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    722278
   04613 Neutrophil extracellular trap formation
    722278
   04650 Natural killer cell mediated cytotoxicity
    722278
   04662 B cell receptor signaling pathway
    722278
   04664 Fc epsilon RI signaling pathway
    722278
   04666 Fc gamma R-mediated phagocytosis
    722278
   04672 Intestinal immune network for IgA production
    722278
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    722278
  09163 Immune disease
   05310 Asthma
    722278
   05322 Systemic lupus erythematosus
    722278
   05323 Rheumatoid arthritis
    722278
   05320 Autoimmune thyroid disease
    722278
   05330 Allograft rejection
    722278
   05340 Primary immunodeficiency
    722278
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    722278
   05416 Viral myocarditis
    722278
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    722278
   05150 Staphylococcus aureus infection
    722278
   05152 Tuberculosis
    722278
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    722278
   05169 Epstein-Barr virus infection
    722278
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    722278
   05140 Leishmaniasis
    722278
   05143 African trypanosomiasis
    722278
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    722278
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Opsonins
    722278
SSDB
Motif
Pfam: V-set Ig_3 ig Inhibitor_I68 I-set
Other DBs
NCBI-GeneID: 722278
NCBI-ProteinID: XP_028707832
LinkDB
Position
7
AA seq 199 aa
MDLLCKNMKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCAVSGGSISGGYD
WSWIRQPPGKGLEWIGYIYGSSGSTNYNPSLKNRVTISKDTSKNQFSLKLSSVTAADTAV
YYCARHTVRGGECEPRHKPPCREAEGAGAGAAQDQQGARGAHRAGGRVRSRCREGGASSS
AQCSPSSPAHQLSPGLLFL
NT seq 600 nt   +upstreamnt  +downstreamnt
atggacctcctgtgcaagaacatgaagcacctgtggttcttcctcctcctggtggcagct
cccagatgggtcctgtcccaggtgcagctgcaggagtcgggcccaggactggtgaagcct
tcagagaccctgtccctcacctgcgctgtctctggaggctctatcagcggtggttatgac
tggagctggatccgccagcccccagggaaggggctggagtggattgggtatatctatggt
agtagtgggagcaccaactacaacccgtccctcaagaatcgagtcaccatttcaaaagac
acgtccaagaaccagttctccctgaagctgagctctgtgaccgccgcggacacggccgtg
tattactgtgcgagacacacagtgaggggaggtgagtgtgagcccagacacaaacctccc
tgcagggaggcggagggggcgggcgcaggtgccgctcaggaccagcagggggcgcgcggg
gcccacagagcaggaggccgggtcaggagcaggtgcagggagggcggggcttcctcatct
gctcagtgctctccctcctcaccagcacatcagctgtccccagggctcctctttctttga

DBGET integrated database retrieval system