KEGG   Macaca mulatta (rhesus monkey): 106997584
Entry
106997584         CDS       T01028                                 

Gene name
MYL10
Definition
(RefSeq) myosin regulatory light chain 10 isoform X3
  KO
K12756  myosin regulatory light chain 10
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04510  Focal adhesion
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106997584 (MYL10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106997584 (MYL10)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    106997584 (MYL10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106997584 (MYL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    106997584 (MYL10)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     106997584 (MYL10)
SSDB
Motif
Pfam: EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_5 TC1 LcrV
Other DBs
NCBI-GeneID: 106997584
NCBI-ProteinID: XP_014990003
Ensembl: ENSMMUG00000030385
UniProt: F7H6W4
LinkDB
Position
3
AA seq 226 aa
MLPRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLA
LSPRLECNSVISAHCNLHLTGSRNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRIN
VKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIK
EKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 681 nt   +upstreamnt  +downstreamnt
atgttgcctaggctcgtctcaaactcctggcctcaagtgatcctccctcctcggcctccc
aaagtgctaggattacaggcaccgagaagagctcggaaaagagcagaaggcactgccagc
tccaacgtcttctccatgtttgatcagtcccagatccaggagtttaaagagagtctggct
ctgtcgcccaggctggagtgcaatagcgtgatctccgctcattgcaacctccacctcacg
ggttcaaggaattctcctgcctcagcctcccaagctttcaccatcatggaccagaaccgc
gatggcttcatcgacaaagaggacttgagggacacctttgccgcactgggccgcatcaat
gtcaagaacgaggaactggaggccatggtgaaggaggcccccggacccatcaacttcacg
gtgttcctgacaatgtttggggagaagctgaagggcacggacccagaggagaccattctc
cacgccttcaaagtgttcgacactgaaggaaaaggttttgtcaaggccgatgtcatcaaa
gaaaaacttatgacccaggcagaccgcttcagtgaggaggaggtcaagcagatgtttgca
gcgttccccccagatgtgtgcggcaacctggactacagaaacctgtgctacgtcatcact
catggtgaagagaaggattag

KEGG   Macaca mulatta (rhesus monkey): 694957
Entry
694957            CDS       T01028                                 

Gene name
MYL12B
Definition
(RefSeq) myosin regulatory light chain 12B
  KO
K12757  myosin regulatory light chain 12
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04530  Tight junction
mcc04611  Platelet activation
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    694957 (MYL12B)
   04530 Tight junction
    694957 (MYL12B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    694957 (MYL12B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    694957 (MYL12B)
   04670 Leukocyte transendothelial migration
    694957 (MYL12B)
  09158 Development and regeneration
   04360 Axon guidance
    694957 (MYL12B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    694957 (MYL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    694957 (MYL12B)
   04147 Exosome [BR:mcc04147]
    694957 (MYL12B)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     694957 (MYL12B)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   694957 (MYL12B)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 SPARC_Ca_bdg DUF2666 DUF3741 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 694957
NCBI-ProteinID: NP_001252888
Ensembl: ENSMMUG00000047848
UniProt: F6RFU8 A0A5F7ZCE4
LinkDB
Position
18
AA seq 172 aa
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcgagcaaaaaggcaaagaccaagaccaccaagaagcgccctcagcgcgcaacatcc
aatgtgtttgccatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatg
attgatcagaatagagatggcttcatcgacaaggaagatttgcatgatatgcttgcttct
ctagggaagaatcccactgatgcataccttgatgccatgatgaatgaggcaccagggccc
atcaatttcaccatgttcctcaccatgtttggtgagaagttaaatggcacggatcctgaa
gatgtcatcagaaatgcttttgcttgctttgatgaagaagcaactggcaccattcaggaa
gattacctgagagagctgctgacaaccatgggggatcggtttacggatgaggaagtggat
gagctgtacagagaagcacctattgacaaaaaggggaatttcaattacatcgagttcaca
cgcatcctgaaacatggagcaaaagacaaagatgactga

KEGG   Macaca mulatta (rhesus monkey): 695077
Entry
695077            CDS       T01028                                 

Gene name
MYL12A
Definition
(RefSeq) myosin, light chain 12A, regulatory, non-sarcomeric isoform X1
  KO
K12757  myosin regulatory light chain 12
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04530  Tight junction
mcc04611  Platelet activation
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    695077 (MYL12A)
   04530 Tight junction
    695077 (MYL12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    695077 (MYL12A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    695077 (MYL12A)
   04670 Leukocyte transendothelial migration
    695077 (MYL12A)
  09158 Development and regeneration
   04360 Axon guidance
    695077 (MYL12A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    695077 (MYL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    695077 (MYL12A)
   04147 Exosome [BR:mcc04147]
    695077 (MYL12A)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     695077 (MYL12A)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   695077 (MYL12A)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 SPARC_Ca_bdg DUF3741 DUF2666
Other DBs
NCBI-GeneID: 695077
NCBI-ProteinID: XP_014977113
Ensembl: ENSMMUG00000019893
UniProt: F6T8J2
LinkDB
Position
18
AA seq 177 aa
MDLTTTMSSKRAKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLH
DMLASLGKNPTDDYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEAT
GTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 534 nt   +upstreamnt  +downstreamnt
atggacttaaccaccaccatgtcaagcaaaagagcaaagaccaagaccaagaagcgccct
cagcgcgcaacatccaatgtgtttgccatgtttgaccagtcacagattcaggagttcaaa
gaggccttcaacatgattgatcagaacagagatggtttcatcgacaaggaagatttgcat
gatatgcttgcttcattggggaagaatccaactgatgattatctggatgccatgatgaat
gaagctccaggccccatcaatttcaccatgttccttaccatgtttggtgagaagttaaat
ggcacggatcctgaagatgtcatcagaaatgcttttgcttgctttgatgaagaagcaact
ggcaccattcaggaagattacctgagagagctgctgacaaccatgggggatcggtttacg
gatgaggaagtggatgagctgtacagagaagcacctattgacaaaaaggggaatttcaat
tacatcgagttcacgcgcatcctgaaacatggagcaaaagacaaagatgactga

KEGG   Macaca mulatta (rhesus monkey): 697765
Entry
697765            CDS       T01028                                 

Gene name
MYL5
Definition
(RefSeq) myosin light chain 5 isoform X1
  KO
K12753  myosin regulatory light chain 5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    697765 (MYL5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    697765 (MYL5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    697765 (MYL5)
  09158 Development and regeneration
   04360 Axon guidance
    697765 (MYL5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    697765 (MYL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    697765 (MYL5)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     697765 (MYL5)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_4 Caleosin Lipoprotein_6 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 697765
NCBI-ProteinID: XP_028704031
LinkDB
Position
5
AA seq 173 aa
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNMFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTADEVDQMFQFASIDAAGNLDYKALSYVITHGEEKEE
NT seq 522 nt   +upstreamnt  +downstreamnt
atggccagcaggaagaccaagaagaaggaagggggtgccctccgggcccagagagcctca
tccaatgtcttctccaactttgagcagactcagatccaggagttcaaggaggcattcaca
ctcatggatcagaaccgagacggcttcatcgacaaggaggacctgaaggacacctacgcc
tccctgggcaagaccaatgtcaaggacgatgagctggacgccatgctcaaagaggcctcg
gggcccatcaacttcaccatgtttctgaacatgtttggggagaagctgagtggtaccgat
gccgaggagaccattctaaacgccttcaagatgctggacccagacgggaaagggaaaatc
aacaaggagtacatcaagcgtctgctgatgtcccaggctgacaagatgacagcggatgag
gtggaccagatgttccagttcgcctccatcgatgccgcgggcaacctggactacaaggcg
ctgagctacgtgatcacccacggggaggaaaaggaggagtga

KEGG   Macaca mulatta (rhesus monkey): 707293
Entry
707293            CDS       T01028                                 

Gene name
MYL7
Definition
(RefSeq) myosin regulatory light chain 2, atrial isoform
  KO
K12754  myosin regulatory light chain 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04510  Focal adhesion
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    707293 (MYL7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    707293 (MYL7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    707293 (MYL7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    707293 (MYL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    707293 (MYL7)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     707293 (MYL7)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7 EF-hand_5 CHCH EF-hand_9
Other DBs
NCBI-GeneID: 707293
NCBI-ProteinID: XP_001095719
Ensembl: ENSMMUG00000002426
UniProt: A0A1D5QZ41
LinkDB
Position
3
AA seq 175 aa
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKEEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 528 nt   +upstreamnt  +downstreamnt
atggccagcaggaaggcggggacccgaggcaaagtggcggccaccaagcaggcccaacgt
ggttcttccaacgtcttttccatgtttgaacaagcccagatccaggagttcaaggaagcc
ttcagctgtatcgaccagaatcgtgatggcatcatctgcaaggcagacctgagggagacc
tactcccagctggggaaggtgagtgtcccagaggaggagctggacgccatgctgcaggag
ggcaagggtcccatcaacttcaccgtcttcctcacgctctttggggagaagctcaatggg
acagaccccgaggaagccatcctgagtgccttccgcatgtttgaccccagtggcaaaggg
gtggtgaacaaggaagagtttaagcagcttctcctgacccaggcagacaagttctctcca
gctgaggtggagcagatgttcgccctgacacccatggacctggcggggaacatcgactac
aagtcactgtgctacatcatcacccatggagacgagaaagaggaatga

KEGG   Macaca mulatta (rhesus monkey): 709784
Entry
709784            CDS       T01028                                 

Gene name
MYL9
Definition
(RefSeq) myosin regulatory light polypeptide 9
  KO
K12755  myosin regulatory light chain 9
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04530  Tight junction
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc04921  Oxytocin signaling pathway
mcc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    709784 (MYL9)
   04022 cGMP-PKG signaling pathway
    709784 (MYL9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    709784 (MYL9)
   04530 Tight junction
    709784 (MYL9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    709784 (MYL9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    709784 (MYL9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    709784 (MYL9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    709784 (MYL9)
  09158 Development and regeneration
   04360 Axon guidance
    709784 (MYL9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    709784 (MYL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    709784 (MYL9)
   04147 Exosome [BR:mcc04147]
    709784 (MYL9)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     709784 (MYL9)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   709784 (MYL9)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 709784
NCBI-ProteinID: XP_015004541
Ensembl: ENSMMUG00000041652
UniProt: G7N4X7 A0A663D847
LinkDB
Position
10
AA seq 172 aa
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtccagcaagcgggccaaagccaagaccaccaagaagcggccacagcgggccacatcc
aatgtcttcgcaatgtttgaccagtcccagatccaggagtttaaggaggctttcaacatg
attgaccagaaccgtgatggcttcattgacaaggaggacctgcacgacatgctggcctcg
ctggggaagaaccccacagacgaatacctggagggcatgatgagcgaggccccggggccc
atcaacttcaccatgttcctcaccatgtttggggagaagctgaacggcacggaccccgag
gatgtgattcgcaacgcttttgcctgcttcgacgaggaagcctcaggtttcatccatgag
gaccacctccgggagctgctcaccaccatgggtgaccgcttcacggacgaggaagtggat
gagatgtaccgggaggcgcccattgataagaaaggaaacttcaactacgtggagttcacc
cgcatcctcaaacatggcgccaaggataaagacgactag

KEGG   Macaca mulatta (rhesus monkey): 711778
Entry
711778            CDS       T01028                                 

Gene name
MYLPF
Definition
(RefSeq) myosin regulatory light chain 2, skeletal muscle isoform
  KO
K12758  fast skeletal myosin light chain 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04510  Focal adhesion
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    711778 (MYLPF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    711778 (MYLPF)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    711778 (MYLPF)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    711778 (MYLPF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    711778 (MYLPF)
   04147 Exosome [BR:mcc04147]
    711778 (MYLPF)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     711778 (MYLPF)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   711778 (MYLPF)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 711778
NCBI-ProteinID: XP_014981426
Ensembl: ENSMMUG00000021847
UniProt: F7EI96
LinkDB
Position
20
AA seq 169 aa
MAPKKAKRRAVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFL
EELLTTQCDRFTPEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
NT seq 510 nt   +upstreamnt  +downstreamnt
atggcacccaagaaggccaagagaagggcagtagagggtggaagttccagcgtcttctcc
atgtttgaccagactcagatccaggagttcaaggaggccttcactgtgatcgaccagaac
cgtgatggtattatcgacaaggaggaccttcgggacaccttcgcagccatgggccgcctc
aatgtgaagaatgaggagttggatgccatgatgaaggaagccagtggtcccatcaacttc
accgtcttcctgaccatgttcggggaaaagctcaagggtgccgaccctgaggatgtgata
actggagccttcaaggtcctggaccctgaaggaaagggcaccatcaagaagaagttcctg
gaggagctgctgaccacgcagtgtgaccgcttcaccccggaggagatcaagaacatgtgg
gctgctttcccccccgacgtgggcggcaacgtcgactacaaaaacatctgctacgtcatc
acgcacggcgacgccaaggaccaggagtag

KEGG   Macaca mulatta (rhesus monkey): 711937
Entry
711937            CDS       T01028                                 

Gene name
MYL2
Definition
(RefSeq) myosin regulatory light chain 2, ventricular/cardiac muscle isoform
  KO
K10351  myosin regulatory light chain 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04260  Cardiac muscle contraction
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04371  Apelin signaling pathway
mcc04510  Focal adhesion
mcc04530  Tight junction
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05132  Salmonella infection
mcc05410  Hypertrophic cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    711937 (MYL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    711937 (MYL2)
   04530 Tight junction
    711937 (MYL2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    711937 (MYL2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    711937 (MYL2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    711937 (MYL2)
   04261 Adrenergic signaling in cardiomyocytes
    711937 (MYL2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    711937 (MYL2)
   05414 Dilated cardiomyopathy
    711937 (MYL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    711937 (MYL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    711937 (MYL2)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     711937 (MYL2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_11
Other DBs
NCBI-GeneID: 711937
NCBI-ProteinID: XP_015008282
Ensembl: ENSMMUG00000002347
UniProt: A0A1D5RDY5 G7N5H5
LinkDB
Position
11
AA seq 166 aa
MAPKKAKKRAQGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR
DMLTTQAERFSKEEIDQMFAAFPPDVTGNLNYKNLVHIITHGEEKD
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcacctaagaaagcaaagaagagagcccagggcgccaactccaacgtgttctccatg
ttcgaacagacccaaatccaggaatttaaggaggccttcactatcatggaccagaacagg
gatggcttcatcgacaagaacgatctgagagacacctttgctgcccttgggcgtgtgaac
gtgaaaaatgaagaaattgatgaaatgatcaaggaggctccgggtccaattaactttact
gtgttcctcacaatgtttggggagaaacttaagggagcagaccctgaggaaaccatactc
aatgcattcaaagtgtttgaccctgaaggcaaaggggtgctgaaggctgattacgttcgg
gacatgctgaccacgcaggcggagaggttttccaaggaggagattgaccagatgttcgcc
gccttcccccctgacgtgactggcaacttgaactacaagaacctggtgcacatcatcacc
cacggagaagagaaggactag

DBGET integrated database retrieval system