KEGG   Macaca mulatta (rhesus monkey): 114669851
Entry
114669851         CDS       T01028                                 

Definition
(RefSeq) receptor-type tyrosine-protein kinase FLT3
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05221  Acute myeloid leukemia
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114669851
   04014 Ras signaling pathway
    114669851
   04151 PI3K-Akt signaling pathway
    114669851
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    114669851
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114669851
   05202 Transcriptional misregulation in cancer
    114669851
   05230 Central carbon metabolism in cancer
    114669851
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    114669851
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    114669851
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    114669851
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     114669851
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   114669851
CD molecules [BR:mcc04090]
 Proteins
  114669851
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_2 Ig_3 APH
Other DBs
NCBI-GeneID: 114669851
NCBI-ProteinID: XP_028698611
LinkDB
Position
17
AA seq 798 aa
MGALRFTGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRECTRLFTIDLNQTPQT
TLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGSYFEMSTYSTNRTMIRILFA
FVSSVARNNTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYEIDQYEEFCFSVRFKA
YPQIRCTWTFSRKSFPCEQKALDDGYSVSKFCNHKHQPGEYIFHAENGDAQFTKMFTLNI
RRKPQVLAEASASQASCSSDGYPLPSWTWKKCSDKSPNCTEDIPEGVWNRKANRKVFGQW
VSSSTLNMSEAMKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQDSISFYATIGVCLLFI
VVLTMLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFRDCDYDLKWEFPRENLEFGKV
LGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMSELKMMTQLGSHENIV
NLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNS
SMPGSRDVQIHPHSDPISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQV
AKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDSNYVVRGNARLPVKWM
APESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIRNGFKMDQPFYAT
EEIYIIMQSCWAFDSRKRPSFPHLTSFLGCQLEDAEEAMYQNVDGRVSERPHIYQNRRPF
SREMDSGPLSPKAQVEDS
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgggtgctttgcgattcacaggggaaagttgtaaagaagaaagtccagcagttgttaaa
aaggaggagaaagtgcttcatgaattatttgggacggacataaggtgctgtgccagaaat
gaactgggcagggaatgcaccaggctgttcacaatagatctaaatcaaactcctcagacc
acattgccacaattatttcttaaagtgggggaacccttatggataaggtgcaaagctgtt
catgtgaaccatggattcgggctcacctgggaattagaaaacaaagcacttgaggagggc
agctactttgagatgagtacctattcaacaaacagaactatgatacggattctgtttgct
tttgtatcatcagtggcaagaaacaacacgggatactacacttgttcctcttcaaagcat
cccagtcaatccgctttggttaccatcgtagaaaagggatttataaatgctaccaattca
agtgaagattatgaaattgaccaatatgaagagttttgtttttccgtcaggtttaaagcc
tacccacaaatcagatgtacatggaccttctctcgaaaatcatttccttgtgagcaaaag
gctctcgatgacggatacagcgtatccaagttttgcaatcataagcaccagccaggagaa
tatatattccatgcagaaaatggtgatgcccaatttaccaaaatgttcacgctgaatata
agaaggaaacctcaagtgctcgcggaagcatcagcgagtcaggcgtcctgttcctcggat
ggatacccattaccatcttggacctggaagaagtgttcagacaagtctcctaactgcaca
gaagacatcccagaaggagtctggaatagaaaggctaacagaaaagtgtttggacagtgg
gtgtccagcagtactctaaacatgagtgaagccatgaaagggttcctggtcaagtgctgt
gcatacaattcccttggcacatcttgtgagacgatccttttaaactctccaggccccttc
cctttcatccaagacagcatctcattctatgcaacaattggtgtttgtctcctcttcatt
gtcgttttaaccatgctgatttgtcacaagtacaaaaagcaatttaggtatgaaagccag
ctacagatggtacaggtgaccggctcctcagataatgagtacttctacgttgatttcaga
gactgtgactatgatctcaaatgggagtttccaagagaaaatttagagtttgggaaggtg
ctaggatcaggggcttttggaaaagtgatgaacgcaacagcttatggaattagcaaaaca
ggagtctcaatccaggttgcagtcaaaatgctgaaagaaaaagcagacagctctgaaaga
gaggcactcatgtcagaactcaagatgatgacccagctgggaagccacgagaatattgtg
aacctgctgggggcgtgcacgctgtcaggaccaatttacttgatttttgaatattgttgc
tatggtgatcttctcaactatctaagaagtaaaagagaaaaatttcacaggacttggaca
gagattttcaaggaacacaatttcagtttttaccccactttccaatcacatccaaattcc
agcatgcctggttcaagagacgttcagatacacccgcactcggatccaatctcagggctt
catgggaattcatttcactctgaagatgaaattgaatatgaaaaccaaaaaaggctggaa
gaagaggaggacttgaatgtgcttacatttgaagatcttctttgctttgcatatcaagtt
gccaaaggaatggaatttctggaatttaagtcgtgtgttcacagagacctggccgccagg
aacgtgcttgtcacccacgggaaagtggtgaagatatgtgactttggattggctcgagat
atcatgagtgattccaactatgttgtcaggggcaatgcccgtctgcctgtaaaatggatg
gcccctgaaagcctatttgaagggatctataccattaagagtgatgtctggtcatacgga
atattactgtgggaaatcttctcacttggtgtgaatccttaccctggcattccggttgat
gctaacttctacaaactgattcgaaatggatttaaaatggatcagccattttatgctaca
gaagaaatatacattataatgcaatcctgctgggcttttgactcaaggaagcggccatcc
ttccctcatttgacttcatttttaggatgtcagctggaggatgcggaagaagcgatgtat
cagaatgtggatggccgtgtttcggaacgtcctcacatctaccaaaacaggcgacctttc
agcagagagatggattcagggccactctctccaaaggctcaggtcgaagattcatag

DBGET integrated database retrieval system