KEGG   Macaca mulatta (rhesus monkey): 114669851
Entry
114669851         CDS       T01028                                 

Definition
(RefSeq) receptor-type tyrosine-protein kinase FLT3
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05221  Acute myeloid leukemia
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114669851
   04014 Ras signaling pathway
    114669851
   04151 PI3K-Akt signaling pathway
    114669851
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    114669851
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114669851
   05202 Transcriptional misregulation in cancer
    114669851
   05230 Central carbon metabolism in cancer
    114669851
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    114669851
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    114669851
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    114669851
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     114669851
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   114669851
CD molecules [BR:mcc04090]
 Proteins
  114669851
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_2 Ig_3 APH
Other DBs
NCBI-GeneID: 114669851
NCBI-ProteinID: XP_028698611
LinkDB
Position
17
AA seq 798 aa
MGALRFTGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRECTRLFTIDLNQTPQT
TLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGSYFEMSTYSTNRTMIRILFA
FVSSVARNNTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYEIDQYEEFCFSVRFKA
YPQIRCTWTFSRKSFPCEQKALDDGYSVSKFCNHKHQPGEYIFHAENGDAQFTKMFTLNI
RRKPQVLAEASASQASCSSDGYPLPSWTWKKCSDKSPNCTEDIPEGVWNRKANRKVFGQW
VSSSTLNMSEAMKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQDSISFYATIGVCLLFI
VVLTMLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFRDCDYDLKWEFPRENLEFGKV
LGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMSELKMMTQLGSHENIV
NLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNS
SMPGSRDVQIHPHSDPISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQV
AKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDSNYVVRGNARLPVKWM
APESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIRNGFKMDQPFYAT
EEIYIIMQSCWAFDSRKRPSFPHLTSFLGCQLEDAEEAMYQNVDGRVSERPHIYQNRRPF
SREMDSGPLSPKAQVEDS
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgggtgctttgcgattcacaggggaaagttgtaaagaagaaagtccagcagttgttaaa
aaggaggagaaagtgcttcatgaattatttgggacggacataaggtgctgtgccagaaat
gaactgggcagggaatgcaccaggctgttcacaatagatctaaatcaaactcctcagacc
acattgccacaattatttcttaaagtgggggaacccttatggataaggtgcaaagctgtt
catgtgaaccatggattcgggctcacctgggaattagaaaacaaagcacttgaggagggc
agctactttgagatgagtacctattcaacaaacagaactatgatacggattctgtttgct
tttgtatcatcagtggcaagaaacaacacgggatactacacttgttcctcttcaaagcat
cccagtcaatccgctttggttaccatcgtagaaaagggatttataaatgctaccaattca
agtgaagattatgaaattgaccaatatgaagagttttgtttttccgtcaggtttaaagcc
tacccacaaatcagatgtacatggaccttctctcgaaaatcatttccttgtgagcaaaag
gctctcgatgacggatacagcgtatccaagttttgcaatcataagcaccagccaggagaa
tatatattccatgcagaaaatggtgatgcccaatttaccaaaatgttcacgctgaatata
agaaggaaacctcaagtgctcgcggaagcatcagcgagtcaggcgtcctgttcctcggat
ggatacccattaccatcttggacctggaagaagtgttcagacaagtctcctaactgcaca
gaagacatcccagaaggagtctggaatagaaaggctaacagaaaagtgtttggacagtgg
gtgtccagcagtactctaaacatgagtgaagccatgaaagggttcctggtcaagtgctgt
gcatacaattcccttggcacatcttgtgagacgatccttttaaactctccaggccccttc
cctttcatccaagacagcatctcattctatgcaacaattggtgtttgtctcctcttcatt
gtcgttttaaccatgctgatttgtcacaagtacaaaaagcaatttaggtatgaaagccag
ctacagatggtacaggtgaccggctcctcagataatgagtacttctacgttgatttcaga
gactgtgactatgatctcaaatgggagtttccaagagaaaatttagagtttgggaaggtg
ctaggatcaggggcttttggaaaagtgatgaacgcaacagcttatggaattagcaaaaca
ggagtctcaatccaggttgcagtcaaaatgctgaaagaaaaagcagacagctctgaaaga
gaggcactcatgtcagaactcaagatgatgacccagctgggaagccacgagaatattgtg
aacctgctgggggcgtgcacgctgtcaggaccaatttacttgatttttgaatattgttgc
tatggtgatcttctcaactatctaagaagtaaaagagaaaaatttcacaggacttggaca
gagattttcaaggaacacaatttcagtttttaccccactttccaatcacatccaaattcc
agcatgcctggttcaagagacgttcagatacacccgcactcggatccaatctcagggctt
catgggaattcatttcactctgaagatgaaattgaatatgaaaaccaaaaaaggctggaa
gaagaggaggacttgaatgtgcttacatttgaagatcttctttgctttgcatatcaagtt
gccaaaggaatggaatttctggaatttaagtcgtgtgttcacagagacctggccgccagg
aacgtgcttgtcacccacgggaaagtggtgaagatatgtgactttggattggctcgagat
atcatgagtgattccaactatgttgtcaggggcaatgcccgtctgcctgtaaaatggatg
gcccctgaaagcctatttgaagggatctataccattaagagtgatgtctggtcatacgga
atattactgtgggaaatcttctcacttggtgtgaatccttaccctggcattccggttgat
gctaacttctacaaactgattcgaaatggatttaaaatggatcagccattttatgctaca
gaagaaatatacattataatgcaatcctgctgggcttttgactcaaggaagcggccatcc
ttccctcatttgacttcatttttaggatgtcagctggaggatgcggaagaagcgatgtat
cagaatgtggatggccgtgtttcggaacgtcctcacatctaccaaaacaggcgacctttc
agcagagagatggattcagggccactctctccaaaggctcaggtcgaagattcatag

KEGG   Macaca mulatta (rhesus monkey): 574133
Entry
574133            CDS       T01028                                 

Gene name
FLT1
Definition
(RefSeq) vascular endothelial growth factor receptor 1 isoform X1
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc05202  Transcriptional misregulation in cancer
mcc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    574133 (FLT1)
   04014 Ras signaling pathway
    574133 (FLT1)
   04015 Rap1 signaling pathway
    574133 (FLT1)
   04066 HIF-1 signaling pathway
    574133 (FLT1)
   04020 Calcium signaling pathway
    574133 (FLT1)
   04151 PI3K-Akt signaling pathway
    574133 (FLT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    574133 (FLT1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    574133 (FLT1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    574133 (FLT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    574133 (FLT1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     574133 (FLT1)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   574133 (FLT1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase ig Ig_2 V-set VEGFR-2_TMD Ig_6 Ig_4 C1-set Ig_5 Adeno_E3_CR1
Other DBs
NCBI-GeneID: 574133
NCBI-ProteinID: XP_001117928
Ensembl: ENSMMUG00000021538
UniProt: G7NJV3
LinkDB
Position
17
AA seq 1338 aa
MVFCWDTGVLLCALLGCLLLTGSSSGSKLKGPELSLKGTQHVTQAGQTLHLQCRGEAAHQ
WSLPETVSKESKRLSITKSACGRNGKQFCSTLTLNAAQANHTGFYSCKYLAVPTSKKKET
ESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELIIPCRVTSPNITVTLKKFPLDTLIPD
GKRVIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
KLLRGHTLILNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSILTIDK
VQNKDKGLYTCRVRSGPSFKYVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK
AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPRPTIKWCWRPCNHNHSEARY
DFCSNNEESFILDPDSNIGNRIESITQRMAIIEGKNKTASTLVVADSRISGIYSCIASNK
VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSLEDSGTYACRARNVYTGEEILQKKEVTIRDQEA
PYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIER
VTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFI
RKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK
VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSV
TSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKEGISA
PKFNSESSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW
TDSKPKASLKIDLRVTSKSKESGLSDASRPSFCHSSCGHISEGKRRFTYDNAELERKIAC
CSPPPDYNSVVLYSTPPV
NT seq 4017 nt   +upstreamnt  +downstreamnt
atggtcttctgctgggacaccggggtcctgctgtgtgcgctgctaggctgtctgcttctc
acaggatctagttcaggttcaaaattaaaaggtcctgaactgagtttaaaaggcacccag
cacgtcacgcaagcaggccagacactgcatctccaatgcaggggggaagcagcccatcaa
tggtctttgcctgaaacggtgagtaaggaaagcaaaaggctaagcataactaaatctgcc
tgtggaagaaatggcaaacaattctgcagtactttgaccttgaatgcagctcaagcaaac
cacactggcttctacagctgcaaatatctagctgtacctacttcaaagaagaaggaaaca
gaatctgcaatctatatatttattagtgatacaggtagacctttcgtagagatgtacagt
gaaatccccgaaattatacacatgactgaaggaagggagctcatcattccctgccgggtc
acatcacctaacatcactgttactttaaaaaagtttccacttgacactttgatccctgat
ggaaaacgtgtaatctgggacagcagaaagggcttcatcatatcaaatgcaacgtacaaa
gaaatagggcttctgacctgtgaagccacagtcaatggacatttgtataagacaaactat
ctcacacatcgacaaaccaatacaatcatagatgtccaaataagcacaccacgcccagtc
aaattacttagaggccatactcttatcctcaattgtactgctaccactcccttgaacacg
agagttcaaatgacctggagttaccctgatgaaaaaaataagagagcttctgtaaggcga
cgaattgaccaaagcaattcccatgccaacatattctacagtattcttactattgacaaa
gtgcagaacaaagacaaaggactttatacttgtcgtgtaaggagtggaccatcattcaaa
tacgttaacacctcagtgcatatatatgataaagccttcatcactgtgaaacatcgaaaa
cagcaggtgctcgaaactgtagctggcaagcggtcttaccggctgtctatgaaagtgaag
gcgtttccctcgccggaagttgtatggttaaaagatgggttacctgcgaccgagaaatct
gctcgctatttgactcggggctattcattaattatcaaggatgtaactgaagaggatgca
gggaattatacaatcttgctgagcataaaacagtcaaatgtgttcaaaaacctcactgcc
actctaattgtcaatgtgaaaccccagatttatgaaaaggccgtgtcatcatttccagac
ccagctctctacccactgggcagcagacaaatcctgacttgtaccgcatacggtatccct
cgacctacaatcaagtggtgctggcgcccctgtaaccataatcattctgaagcaaggtat
gacttttgttccaataatgaagagtcctttatcctggatcctgacagcaacataggaaac
agaattgagagcatcactcagcgcatggcaataatagaaggaaagaataagacggctagc
accttggttgtggctgactctagaatttctggaatctacagttgcatagcttccaataaa
gttgggacggtgggaagaaacataagcttttatatcacagatgtgccaaatgggtttcac
gttaacttggaaaaaatgccgacggaaggagaggacctgaaactgtcttgcacagttaac
aagttcttatacagagatgttacgtggattttactgcggacagttaataacagaacaatg
cactacagtattagcaagcaaaaaatggccatcactaaggagcactccatcactcttaat
cttaccatcatgaatgtttccctggaagattcaggcacctatgcctgcagagccaggaat
gtatacacaggggaagaaatcctccagaagaaagaagttacaatcagagatcaggaagca
ccatacctcctgcgaaacctcagcgatcacacagtggccatcagcagttccaccacttta
gactgtcatgctaatggtgtccccgaacctcagatcacttggtttaaaaacaaccacaaa
atacaacaagagcctggaattattttaggaccaggaagcagcacgctgtttattgaaaga
gtcacagaagaggatgaaggtgtctatcactgcaaagccaccaaccagaagggctccgtg
gaaagttcagcatacctcactgttcaaggaacctcggacaagtctaatctggagctgatc
actctaacatgcacctgtgtggctgcgactctcttctggctcctattaaccctctttatc
cgaaaaatgaaaaggtcttcttctgaaataaagactgactacctatcaattataatggac
cccgatgaagttcccctggatgagcagtgtgagcggctcccttatgatgccagcaagtgg
gagtttgcccgggagagacttaaactgggcaaatcacttggaagaggggcttttggaaaa
gtggttcaagcatcagcatttggcattaagaaatcacctacatgccggactgtggctgtg
aaaatgctgaaagagggggccacggccagcgagtacaaagctctgatgactgagctcaaa
atcttgacccacattggccaccatctgaacgtggttaacctgctgggagcctgcaccaag
caaggagggcctctgatggtgattgttgaatactgcaaatatggaaatctatccaactac
ctcaagagcaaacgtgacttattttttctcaacaaggatgcagcattacacatggagcct
aagaaagaaaaaatggagccaggcctggaacaaggcaagaaaccaagactagatagtgtc
accagcagcgagagctttgcgagctccgggtttcaggaagataaaagtctgagtgatgtt
gaggaagaggaggattctgatggtttctacaaggagcccatcactatggaagatctgatt
tcttacagttttcaagtggccagaggcatggagttcctgtcttccagaaagtgcattcat
cgggacctggcagcgagaaacattcttttatctgagaacaatgtggtgaagatttgtgat
tttggcctcgcccgggatatttataagaaccccgattatgtgagaaaaggagatactcga
cttcctctgaaatggatggctcctgaatctatctttgacaaaatctacagcaccaagagc
gacgtgtggtcttacggagtattgctgtgggaaatcttctccttaggcgggtctccatac
ccaggagtacaaatggatgaggacttttgcagtcgcctgagggaaggcatgaggatgaga
gctcctgagtactctactcctgaaatctatcagatcatgctggactgctggcacagagac
ccaaaagaaaggccaagatttgcagaacttgtggaaaaactgggtgatttgcttcaagca
aatgtacaacaggatggtaaagactacatcccaatcaatgccatactgacaggaaatagt
gggtttacatactcaactcctgccttctctgaggacttcttcaaggaaggtatttcggct
ccgaagtttaattcagaaagctctgatgatgtcagatatgtaaatgctttcaagttcatg
agcctggaaagaatcaaaacctttgaagaacttttaccaaatgccacctccatgtttgat
gactaccagggggacagcagcactctgttggcctctcccatgctgaagcgcttcacctgg
actgacagcaaacccaaggcctcgctcaagattgacttgagagtcaccagtaaaagtaag
gagtcggggctttctgatgccagcaggcccagtttctgccattccagctgtgggcacatc
agcgaaggcaagcgcaggttcacctacgacaacgctgagctggaaaggaaaatcgcgtgc
tgctccccgcccccagactacaactcggtggtcctgtactccaccccacccgtctag

KEGG   Macaca mulatta (rhesus monkey): 574304
Entry
574304            CDS       T01028                                 

Gene name
NGFR
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 16
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04215  Apoptosis - multiple species
mcc04722  Neurotrophin signaling pathway
mcc05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    574304 (NGFR)
   04014 Ras signaling pathway
    574304 (NGFR)
   04015 Rap1 signaling pathway
    574304 (NGFR)
   04151 PI3K-Akt signaling pathway
    574304 (NGFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574304 (NGFR)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    574304 (NGFR)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    574304 (NGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    574304 (NGFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    574304 (NGFR)
   04090 CD molecules [BR:mcc04090]
    574304 (NGFR)
Cytokine receptors [BR:mcc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   574304 (NGFR)
CD molecules [BR:mcc04090]
 Proteins
  574304 (NGFR)
SSDB
Motif
Pfam: TNFR_16_TM TNFR_c6 Death TPR_21
Other DBs
NCBI-GeneID: 574304
NCBI-ProteinID: XP_001090039
Ensembl: ENSMMUG00000014603
UniProt: F7GQ23
LinkDB
Position
16
AA seq 427 aa
MRAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHGGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTATSTQEPEAPPEQDLIASTVADVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQSHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagggcaggtgccaccggccgcgccatggacgggccgcgcctgctgctgttgctgctt
ctgggggtgtcccttggaggtgccaaggaggcatgccccacaggcctgtacacacatggc
ggcgagtgctgcaaagcctgcaacctgggcgaaggtgtggcccagccttgtggagccaac
cagaccgtgtgtgagccctgcctggacagtgtgacgttctccgacgtggtgagcgcgacg
gagccgtgcaagccgtgcactgagtgcgtggggcttcagagcatgtcggcgccgtgcgtg
gaggccgacgacgccgtgtgccgctgtgcctacggctactaccaggacgagacgaccggg
cgctgcgaggcgtgccgcgtgtgcgaggcgggctcgggcctcgtattctcgtgccaggac
aagcagaacaccgtgtgcgaggagtgccccgacggcacgtattcagatgaggccaaccac
gtggacccgtgcctgccctgcaccgtgtgcgaggacaccgagcgccagctgcgcgagtgc
acacgctgggccgacgccgagtgcgaggagatccctggccgttggattacaaggtccaca
ccccccgaaggctctgacagcacagccaccagcacccaggagcctgaggcacctccagaa
caagacctcatagccagcacagtggcagatgtggtgaccacagtgatgggcagctcccag
cccgtggtaacccgaggcaccaccgacaacctcatccccgtctattgctccatcctggct
gctgtggtggtgggccttgtggcctacatagccttcaagaggtggaacagctgcaagcag
aacaagcaaggagccaacagccggccagtgaaccagacgcccccaccagagggagaaaaa
ctccatagtgacagtggcatctccgtggacagccagagcctgcatgaccagcagtcccac
acgcagacggcctcgggccaggccctcaagggtgatggaggcctctacagcagcctgccc
ccagccaagcgggaggaggtggagaagcttctcaacgggtctgcgggggacacctggcgg
cacctggcgggcgagctgggctaccagcccgagcacatagactcctttacccacgaggcc
tgccccgttcgtgccctgcttgcaagctgggccacccaggacagcgccacactggacgcc
ctcctggccgccctgcgccgcatccagcgagccgacctcgtggagagtctgtgcagtgag
tccactgccacgtccccggtgtga

KEGG   Macaca mulatta (rhesus monkey): 613027
Entry
613027            CDS       T01028                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc05160  Hepatitis C
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    613027 (EGFR)
   04012 ErbB signaling pathway
    613027 (EGFR)
   04014 Ras signaling pathway
    613027 (EGFR)
   04015 Rap1 signaling pathway
    613027 (EGFR)
   04630 JAK-STAT signaling pathway
    613027 (EGFR)
   04066 HIF-1 signaling pathway
    613027 (EGFR)
   04068 FoxO signaling pathway
    613027 (EGFR)
   04020 Calcium signaling pathway
    613027 (EGFR)
   04072 Phospholipase D signaling pathway
    613027 (EGFR)
   04151 PI3K-Akt signaling pathway
    613027 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    613027 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    613027 (EGFR)
   04520 Adherens junction
    613027 (EGFR)
   04540 Gap junction
    613027 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    613027 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    613027 (EGFR)
   04915 Estrogen signaling pathway
    613027 (EGFR)
   04921 Oxytocin signaling pathway
    613027 (EGFR)
   04926 Relaxin signaling pathway
    613027 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    613027 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    613027 (EGFR)
   05206 MicroRNAs in cancer
    613027 (EGFR)
   05205 Proteoglycans in cancer
    613027 (EGFR)
   05230 Central carbon metabolism in cancer
    613027 (EGFR)
   05231 Choline metabolism in cancer
    613027 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    613027 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    613027 (EGFR)
   05212 Pancreatic cancer
    613027 (EGFR)
   05225 Hepatocellular carcinoma
    613027 (EGFR)
   05226 Gastric cancer
    613027 (EGFR)
   05214 Glioma
    613027 (EGFR)
   05218 Melanoma
    613027 (EGFR)
   05219 Bladder cancer
    613027 (EGFR)
   05215 Prostate cancer
    613027 (EGFR)
   05213 Endometrial cancer
    613027 (EGFR)
   05224 Breast cancer
    613027 (EGFR)
   05223 Non-small cell lung cancer
    613027 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    613027 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    613027 (EGFR)
   05171 Coronavirus disease - COVID-19
    613027 (EGFR)
   05163 Human cytomegalovirus infection
    613027 (EGFR)
   05165 Human papillomavirus infection
    613027 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    613027 (EGFR)
   01522 Endocrine resistance
    613027 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    613027 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    613027 (EGFR)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     613027 (EGFR)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   613027 (EGFR)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   613027 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   613027 (EGFR)
  Exosomal proteins of bladder cancer cells
   613027 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT Kdo
Other DBs
NCBI-GeneID: 613027
NCBI-ProteinID: XP_014988922
Ensembl: ENSMMUG00000022394
UniProt: P55245
LinkDB
Position
3
AA seq 1210 aa
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSEFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSSQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCQNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQVMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCARNGPKIPSIATGMVGALLLLLVV
ALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQ
QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTED
SIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLN
TVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV
APQSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctccgggacggccggggccgcgctcctggcgctgctggctgcgctctgcccc
gcgagtcgggctctggaggaaaagaaagtttgccaaggcacgagtaacaaactcacgcag
ttgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaattacctacgtgcagaggaattatgatctttccttcttaaag
accatccaggaggtggctggttatgtcctcatcgccctcaacacagtggagcggattcct
ttggaaaacctgcagatcatcagaggaaacatgtactatgaaaattcctatgccttagca
gtcttatctaactatgatgcaaataaaaccggactgaaggagctgcccatgagaaactta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctgccctgtgcaacgtggag
agcatccagtggcgggacatagtcagcagcgagtttctcagcaacatgtcgatggacttc
cagaaccacctgggcagctgccaaaagtgtgatccaagctgtcccaatgggagctgctgg
ggtgcaggagaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctcc
gggcgctgccgcggcaagtcccccagtgactgctgccacaaccagtgtgccgcgggctgc
acgggcccccgggagagcgactgcctggtctgccgcaaattccgagacgaagccacgtgc
aaggacacctgccccccactcatgctctacaaccccaccacataccagatggatgtgaac
cccgagggcaaatacagctttggtgccacctgcgtgaagaagtgtccccgtaattatgtg
gtgacagatcacggctcgtgcgtccgagcctgcggggccgacagctatgagatggaggaa
gacggcgtccgcaagtgtaagaagtgcgaagggccttgccgcaaagtgtgtaatggaata
ggtattggtgaatttaaagacacactctccataaatgctacaaatattaaacacttcaaa
aactgcacctccatcagtggcgatctccacatcctgccggtggcatttaggggtgactcc
ttcacacacactccgcctctggatccacaggaactggatattctgaaaaccgtaaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggacctccatgctttt
gagaacctagaaatcatacgtggcaggaccaagcaacacggtcagttttctcttgcggtc
gtcagcctgaacataacatccttgggattacgctccctcaaggagataagcgatggagat
gtgataatttcaggaaacaaaaatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccagtcagaaaaccaaaattataagcaacagaggtgaaaacagctgcaag
gccacgggccaggtctgccatgccttgtgctcccccgagggctgctggggcccggagccc
agggactgcgtctcctgccagaatgtcagccgaggcagagaatgcgtggacaagtgcaac
atcctggagggcgagccaagggagtttgtggagaactctgagtgcatacagtgccaccca
gaatgcctgccccaggtcatgaacatcacctgcacaggacggggaccagacaactgtatc
cagtgtgcccactacattgacggcccccactgcgtcaagacctgcccagcaggagtcatg
ggagaaaacaacaccctggtctggaagtacgcagacgccggccacgtgtgccacctgtgc
catccaaactgcacctacggatgcactgggccaggtcttgaaggctgtgcaaggaacggg
cctaagatcccatccatcgccactgggatggtgggggccctcctcttgctgctggtggtg
gccctggggatcggcctcttcatgcgaaggcgccacatcgttcggaagcgcacactgcgg
aggctgctgcaggagagggagcttgtggagcctcttacgcccagtggagaagctcccaac
caagctctcttgaggatcttgaaggaaactgaattcaagaagatcaaagtgctgggctcc
ggtgcgttcggaactgtgtataagggactctggatcccagaaggtgagaaagttaaaatt
cccgtcgctatcaaggaattaagagaagcaacatctccgaaagccaacaaggaaatcctc
gatgaagcctacgtgatggccagcgtggacaacccccatgtgtgccgcctgctgggcatc
tgcctcacctccaccgtgcagctcattacgcagctcatgcccttcggctgcctcctggac
tacgtccgggaacacaaggacaatatcggctcccagtacctgctcaactggtgtgtgcag
attgcaaagggcatgaactacttggaggaccggcgcttggtgcaccgcgacctggcagcc
aggaacgtactggtgaaaacgccacagcatgtcaagatcacggattttgggctggccaaa
ctgctgggtgcagaagagaaagaataccatgcagaaggaggcaaagtgcctatcaagtgg
atggcattggaatcaattttacaccgaatttatacccaccagagtgatgtctggagctac
ggggtgaccgtttgggagttgatgacctttggatccaagccatatgacggaatccctgcc
agcgagatctcctccatcctggagaaaggagaacgcctcccccagccacccatatgtacc
atcgatgtctacatgatcatggtcaagtgctggatgatagacgcagatagtcgcccaaag
ttccgtgagttgatcattgaattctccaaaatggcccgagacccccagcgctaccttgtt
attcagggggatgaaagaatgcatttgccaagccctacagactccaacttctaccgtgcc
ctgatggatgaagaagacatggacgacgtggtggatgccgacgagtacctcatcccacag
caaggcttcttcagcagcccctccacgtcacggactcccctcctgagctctctgagtgca
accagcaacaattccactgtggcttgcattgatagaaatgggctgcaaagctgtcccatc
aaggaagacagcttcttacagcgatacagctcagaccccacaggcgccttgactgaggac
agcatagacgacaccttcctcccagtgcctgaatacataaaccagtctgttcccaaaagg
cccgctggctctgtgcagaatcctgtctatcacaatcagcctctgaaccctgcgcccagc
agagacccacactaccaggacccccacagcaccgcagtgggcaaccccgagtatctcaac
actgtccagcccacctgtgtcaacagcacattcgacagccctgctcattgggcccagaaa
ggcagccaccaaattagcctggacaaccctgactaccagcaggacttctttcccaaggaa
gccaagccaaatggcatctttaagggctccacagctgaaaatgcagaatacctaagggtc
gcaccacaaagcagtgaatttattggagcatga

KEGG   Macaca mulatta (rhesus monkey): 692343
Entry
692343            CDS       T01028                                 

Gene name
EPHA2
Definition
(RefSeq) ephrin type-A receptor 2 precursor
  KO
K05103  Eph receptor A2 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    692343 (EPHA2)
   04014 Ras signaling pathway
    692343 (EPHA2)
   04015 Rap1 signaling pathway
    692343 (EPHA2)
   04151 PI3K-Akt signaling pathway
    692343 (EPHA2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    692343 (EPHA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    692343 (EPHA2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     692343 (EPHA2)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   692343 (EPHA2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Pur_ac_phosph_N Interfer-bind Ephrin_rec_like SKG6 Pkinase_fungal
Other DBs
NCBI-GeneID: 692343
NCBI-ProteinID: NP_001035768
Ensembl: ENSMMUG00000018245
UniProt: Q1HKZ4
LinkDB
Position
1
AA seq 976 aa
MELGAARACFVLLWGCALAPATAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQSLARFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEGSESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPMSMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCESSVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYAKKGDSN
SYNACRTEGFSVTLDDLARHTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGSLAVIGG
VAVCVVLLLLLAGAGFFIHRRRKNLRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGTLKTSSGKKEVPVAIKTLKAGYTEKQRVDF
LGEAGIMGQFSHHNIIRLEGVVSKYKPMMIITEFMENGALDKFLREKDGEFSVLQLVGML
RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP
IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY
SLLGLKDQVNTVGIPI
NT seq 2931 nt   +upstreamnt  +downstreamnt
atggagctcggtgcagcccgcgcctgcttcgtcctgctgtggggctgtgcgctggccccg
gccacggcagcgcagggcaaggaagtggtactgctggactttgctgcagctggaggggag
ctcggctggctcacacacccgtatggcaaagggtgggacctgatgcaaaacatcatgaat
gacatgccgatctacatgtactccgtgtgcaacgtgatgtctggtgaccaggacaactgg
ctccgcaccaactgggtgtaccgaggagaggccgagcgcatcttcattgaactcaagttt
actgtgcgcgactgcaacagcttccctggcggcgccagctcttgcaaggagactttcaac
ctctactatgccgagtcggacctggactatggcaccaacttccagaagcgcctgttcacc
aagattgacaccattgcgcccgatgagatcaccgtcagcagcgacttcgaggcacgccac
gtgaaactgaacgtggaggagcgctccgtggggccgctcacccgcaaaggcttctacctg
gccttccaggatatcggtgcctgtgtggcgctgctctccgtccgtgtctactacaagaag
tgccccgagctgctgcagagcctggcccgctttcctgagaccatcgccggctctgatgca
ccctccctggccactgtggccggcacctgtgtggaccatgccgtggtgccaccggggggt
gaagagccccgtatgcactgtgcagtggatggcgagtggctggtgcccattgggcagtgc
ctgtgccaggcaggctacgagaaggtggaggatgcctgccaggcctgctcgcctggattc
tttaagtttgagggttctgagagcccctgcttggagtgccctgagcacacgctgccatcc
cctgagggtgccacctcctgcgagtgtgaggaaggcttcttccgggcacctcaggaccca
atgtcgatgccctgcacacgacccccctccgccccacactacctcacggccgtgggcatg
ggtgccaaggtggagctgcgctggacaccccctcaggacagtgggggccgcgaggacatc
gtctacagcgtcacctgcgaacagtgctggcccgagtctggggagtgtgggccgtgtgag
tctagtgtgcgctactcagagcctccacacggactgacccgcaccagtgtgacagtcagc
gacctggagcctcacatgaactacaccttcaccgtagaggcccgcaacggcgtctcaggc
ctggtgaccagccgcagcttccgtactgccagtgtcagcatcaaccagacagagcccccc
aaggtgagactggagggccgcagcaccacctcgcttagcgtctcctggagcatccccccg
ccgcagcagagccgcgtgtggaagtacgaggtcacctacgccaagaagggagactccaac
agctacaatgcatgccgcaccgagggtttctccgtgaccctggacgacctggctcggcac
accacctacctggtccaggtgcaggcactgacgcaggagggccagggggccggcagcaag
gtgcacgaattccagacactgtccccggagggatctggctccttggcggtgattggcggt
gtggctgtctgtgtggtcctgcttctgctgctggcaggagctggcttttttatccaccgc
aggaggaagaacctgcgtgcccgccagtccccggaggacgtttacttctccaagtcagaa
caactgaaacccctgaagacatacgtggacccacacacatatgaggaccccaaccaagct
gtgttgaagttcaccaccgagatccatccgtcctgtgtcactcggcagaaggtgatcgga
gcaggagagtttggggaggtgtacaagggcacgctgaagacatcctcggggaagaaggag
gtgcccgtggccatcaagacgctgaaagctggctacacagagaagcagcgagtggacttc
cttggtgaggctggcatcatgggccagttcagccatcacaacatcatccgcctggagggc
gtcgtctccaaatacaagcccatgatgatcatcactgagttcatggagaacggggccctg
gacaagttccttcgggagaaggatggcgagttcagcgtgctgcagctggtgggcatgctg
cggggcatcgcagctggcatgaagtacctggccaacatgaactatgtgcatcgtgacctg
gctgcccgcaacatcctcgtcaacagcaacctggtctgcaaggtgtctgactttggcctg
tcccgcgtgctggaggacgaccccgaggccacctacaccaccagtggcggcaagatcccg
atccgctggacggctccggaggccatttcctaccgcaagttcacctctgccagtgacgtg
tggagctttggcattgtcatgtgggaggtgatgacctatggcgagcggccctactgggag
ctgtccaaccatgaggtgatgaaagcaatcaacgatggcttccggctccccacgcccatg
gactgcccctccgccatctaccagctcatgatgcagtgctggcagcaggagcgtgcccgc
cgccccaagtttgctgacatcgtcagcatcctggacaagctcatccgtgcccctgactcc
ctcaagaccctggctgacttcgacccccgggtgtctatccggctccccagcacaagtggc
tcggagggggtgcccttccgcacggtgtccgagtggctggagtccatcaagatgcagcag
tatacggagcacttcatggcggccggctacactgccatcgagaaggtggtgcagatgacc
aacgacgacatcaagaggattggggtgcggctgcccggccaccagaagcgcatcgcctac
agcctgctgggactcaaggaccaggtgaacacggtggggatccccatctga

KEGG   Macaca mulatta (rhesus monkey): 693341
Entry
693341            CDS       T01028                                 

Gene name
ERBB4
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-4 isoform X1
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04020  Calcium signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc05014  Amyotrophic lateral sclerosis
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    693341 (ERBB4)
   04012 ErbB signaling pathway
    693341 (ERBB4)
   04020 Calcium signaling pathway
    693341 (ERBB4)
   04151 PI3K-Akt signaling pathway
    693341 (ERBB4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    693341 (ERBB4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    693341 (ERBB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    693341 (ERBB4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     693341 (ERBB4)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   693341 (ERBB4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH DUF3951
Other DBs
NCBI-GeneID: 693341
NCBI-ProteinID: XP_014966372
Ensembl: ENSMMUG00000001674
LinkDB
Position
12
AA seq 1308 aa
MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSI
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYD
GEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVP
YRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERS
PRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHSASNGPPKAED
EYVNEPLYLNTFANALGKADYLKNNVLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
NT seq 3927 nt   +upstreamnt  +downstreamnt
atgaagccggcgacaggactttgggtctgggtgagccttctcgtggcggcggggaccgtc
cagcccagcgattctcagtcagtgtgtgcaggaacggagaataaactgagctctctctct
gacctggaacagcagtaccgagccttgcgcaagtactatgaaaactgtgaggttgtcatg
ggcaacctggagataaccagcattgagcacaaccgagacctctcctttctgcggtctgtt
cgagaagtcacaggctatgtgttagtggctcttaatcagtttcgttacctgcctctggag
aatttacgcattattcgtggaacgaaactttatgaggatcgatatgccttggcaatattt
ttaaactacagaaaagatggaaactttggacttcaagaacttggattaaagaacttgaca
gaaatcctaaatggtggagtctatgtagaccagaacaaattcctttgttatgcggacacc
attcattggcaagatattgttcggaacccatggccttccaacttgactcttgtgtcaata
aatggtagttcaggatgtggacgttgccataagtcctgtactggccgttgctggggaccc
acggaaaatcattgccagactttgacaaggacggtgtgtgcagaacaatgtgacggcaga
tgctacgggccttacgtcagtgactgctgccatcgagaatgtgctggaggctgctcagga
cctaaggacacagactgctttgcctgcatgaatttcaatgacagtggagcatgtgttact
cagtgtccccaaacctttgtctacaatccaaccacttttcaactggagcacaatttcaat
gcgaagtacacatatggagcattctgtgtcaagaaatgtccacataactttgtggtagat
tccagttcttgtgtgcgtgcctgccctagttccaagatggaagtagaagaaaatgggatt
aaaatgtgtaaaccttgcactgacatttgcccaaaagcttgtgatggcattggcacagga
tcattgatgtcagctcagactgtggattccagtaacattgacaaattcataaactgtacc
aagatcaatgggaatttgatctttctagtcactggtattcacggggacccttacaatgca
attgaagccatagacccagagaaactgaatgtctttcggacagtcagagagataacaggt
ttcctgaacatacagtcatggccgccaaacatgactgatttcagtgttttttctaaccta
gtgaccattggtggaagagtactctatagtggcctctccttgcttatcctcaagcaacag
ggcatcacctctctacagttccagtccctgaaggaaatcagcgcaggaaacatctatatt
actgacaacagcaacttgtgttattatcataccattaactggacaacactcttcagcaca
atcaaccaaagaatagtaatccgggacaatagaaaagctgaaaactgtactgctgaagga
atggtgtgcaaccatctgtgttccagtgatggctgttggggacctgggccagaccaatgt
ctgtcgtgtcgccgcttcagtagaggaaggatctgcatagagtcttgtaacctctatgat
ggtgaatttcgggagtttgagaacggctccatctgtgtggagtgtgaccctcagtgtgag
aagatggaagatggtctcctcacatgccatggaccgggtcctgacaactgtacaaagtgc
tctcattttaaagatggcccaaactgtgtggaaaaatgtccagatggcttacagggggca
aacagtttcattttcaagtatgctgatccagatcgggagtgccatccatgccatccaaac
tgcacccaagggtgtaatggtcccactagtcatgactgcatttactacccatggacgggc
cattccactttaccacaacatgctagaactcccctgattgcggctggagtaattggtggg
ctcttcattctggtcattgttggtctgacatttgctgtttatgttagaaggaagagcatc
aaaaagaaaagagccttgagaagattcttggaaacagagttggtggaacctttaactccc
agtggcacagcacccaatcaagctcaacttcgtattttgaaagaaactgagttgaagagg
gtaaaagtccttggctcgggtgcttttggaacggtttataaaggcatttgggtacctgaa
ggagaaactgtgaagattcctgtggctattaagattcttaatgagacaactggtcccaag
gcaaatgtggagttcatggatgaagctctgatcatggcaagtatggatcatccacaccta
gtccggttgctgggtgtgtgtctgagcccaaccatccagctggttactcaacttatgccc
catggctgcctgttggagtatgtccacgagcacaaggataacattggatcacaactgctg
cttaactggtgtgtccagatagctaagggaatgatgtacctggaagaaagacggctcgtt
catcgggatttggcggcccgtaatgtcttagtgaaatctccaaaccatgtgaaaatcaca
gattttggactagccagactcttggaaggagatgaaaaagaatacaatgctgatggagga
aagatgccaattaaatggatggctctggagtgtatacattacaggaaattcacccatcag
agtgacgtttggagctatggagttactatatgggaactgatgacctttggaggaaaaccc
tatgatggaattccaacgcgagaaatccctgatttattggagaaaggagaacgtttgcct
cagcctcccatctgcaccattgacgtttacatggtcatggtcaaatgttggatgattgat
gctgacagtagacctaaatttaaggaactggctgctgagttttcaaggatggctcgagac
cctcaaagatacctagttattcagggtgatgatcgtatgaagcttcccagtccaaatgac
agcaagttctttcagaatctcttggatgaagaggatttggaagatatgatggatgctgag
gagtacttggttcctcaggctttcaacatcccacctcccatctatacttccagagcaaga
attgactcgaataggagtgaaattggacacagccctcctcctgcctacacccccatgtca
ggaaatcagtttgtataccgagatggaggttttgctgcagaacaaggagtgtctgtgccc
tacagagccccaactagcacaattccagaagctcctgttgcacagggtgctacagctgag
atttttgatgactcctgctgtaatggcaccctacgcaagccagtggcaccccatgtccaa
gaggacagtagcacccagaggtacagcgctgaccccaccgtgtttgccccagaacggagc
ccacgaggagagctggatgaggaaggttacatgactcctatgcgagacaaacccaaacaa
gaatacctgaatccagtggaggagaacccttttgtttctcggagaaaaaatggagacctt
caagcattggataatcccgaatatcacagtgcatccaatggtccacccaaggccgaggat
gagtatgtgaatgagccgctgtacctcaacacctttgccaacgccttggggaaagctgat
tacctgaagaacaatgtactgtctgtgccagagaaggccaagaaagcgtttgacaaccct
gactactggaaccacagcctgccacctcggagcacccttcagcacccagactacctgcag
gagtacagcacaaaatatttttataaacagaatgggcggatccggcctattgtggcagag
aatccggaatacctctctgagttctccctgaagccaggcactgtgctgccgcctccacct
tacagacaccgaaatactgtagtgtaa

KEGG   Macaca mulatta (rhesus monkey): 696759
Entry
696759            CDS       T01028                                 

Gene name
KIT
Definition
(RefSeq) mast/stem cell growth factor receptor Kit precursor
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04916  Melanogenesis
mcc05200  Pathways in cancer
mcc05221  Acute myeloid leukemia
mcc05224  Breast cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    696759 (KIT)
   04014 Ras signaling pathway
    696759 (KIT)
   04015 Rap1 signaling pathway
    696759 (KIT)
   04072 Phospholipase D signaling pathway
    696759 (KIT)
   04151 PI3K-Akt signaling pathway
    696759 (KIT)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    696759 (KIT)
  09152 Endocrine system
   04916 Melanogenesis
    696759 (KIT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    696759 (KIT)
   05230 Central carbon metabolism in cancer
    696759 (KIT)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    696759 (KIT)
   05224 Breast cancer
    696759 (KIT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    696759 (KIT)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    696759 (KIT)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     696759 (KIT)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   696759 (KIT)
CD molecules [BR:mcc04090]
 Proteins
  696759 (KIT)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 Ig_6 Ig_4 V-set CshA_NR2 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 696759
NCBI-ProteinID: NP_001253024
UniProt: F6V858 H9FU75
LinkDB
Position
5
AA seq 976 aa
MRGARGAWDFLCVLLFLLHVQTGSSQPSVSPGEPSPPSIHPAKSELIVRVGNEIRLLCID
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSSSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTSYSLKGCQGKPLPKDLRFVPDPKAGITIKSVKRAYH
RLCLHCSADQEGKSVLSDKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNASIAFNVYVNTKPEILTYDR
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNASGPPFGKLVVQSSIDS
SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAESALYKNLLHSKESSCSDSTNE
YMDMKPGVSYVVPTKADKRRSARIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
GSTASSSQPLLVHDDV
NT seq 2931 nt   +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggattttctctgcgttctgctcttcctgctccacgtc
cagacaggctcttctcaaccatctgtgagtccaggggaaccgtctccaccatccatccat
ccagcaaaatcagagttaatagtccgcgtgggcaacgagattaggctgttgtgcattgat
ccaggctttgtcaaatggacttttgagatcctggatgaaacgaatgagaataagcagaat
gaatggatcacagaaaaggcagaggccaccaacaccggcaaatacacgtgcaccaacaaa
cacggcttaagcagttccatttatgtgtttgttagagatcctgccaagcttttccttgtt
gaccgctccttgtatgggaaagaagacaatgacacactggtccgctgtcctctcacagac
ccagaagtgaccagttattccctcaaggggtgccaggggaagcctcttcccaaggacttg
aggtttgttcctgaccccaaggctggcatcacgatcaaaagcgtgaaacgcgcctaccat
cggctctgtctgcattgttccgcggaccaggagggcaagtcagtgctgtcggacaagttc
atcctgaaagtgaggccagccttcaaagctgtgcctgttgtgtctgtttccaaagcaagc
tatcttcttagggaaggggaagaattcacagtgacatgcacaataaaagatgtgtctagt
tctgtgtactcaacgtggaaaagagaaaacagtcagactaaactacaggagaaatataat
agctggcatcacggtgacttcaattatgaacgtcaggcaacgttgactatcagttcagcg
agagttaatgattctggagtgttcatgtgttatgccaataatacttttggatcagcaaat
gtcacaacaaccttggaagtagtagataaaggattcattaatatcttccccatgataaac
actacagtatttgtaaacgatggagaaaatgtagatttgattgttgaatatgaggcattc
cccaaacctgaacaccagcagtggatctatatgaacagaaccttcactgataaatgggaa
gattatcccaagtctgagaatgaaagtaatatcagatacgtaagtgaacttcatctaacc
agattaaaaggcactgaaggaggcacttacacattcctagtgtccaattctgacgtcaat
gcttccatagcatttaatgtttatgtgaatacaaaaccagaaatcctgacttacgacagg
ctcgtgaatggcatgctccaatgtgtggcagcaggattcccagaacccacaatagattgg
tatttttgtccgggaactgagcagagatgctctgcttctgtactgccagtggatgtgcag
acactaaacgcatctgggccaccgtttggaaaactagtggttcagagttccatagattct
agtgcattcaagcacaatggcacggttgaatgtaaggcttacaacgatgtgggcaagact
tctgcctattttaactttgcatttaaaggtaacaacaaagagcaaatccatccccacacc
ctgttcactcctttgctgattggttttgtaatcgtagctggcatgatgtgcattattgtg
atgattctcacctacaaatatttacagaaacccatgtatgaagtacagtggaaggttgtt
gaggagataaatggaaacaattacgtttacatagacccaacacaacttccttatgatcac
aaatgggagtttcccagaaacaggctgagttttgggaaaaccctgggtgctggcgctttt
gggaaggttgttgaggcaactgcttatggcttaattaagtcggacgcagccatgactgtc
gctgtaaagatgctcaaaccaagtgcccatttaacagaacgagaagccctcatgtctgaa
ctcaaagtcctgagttaccttggtaatcatatgaatattgtgaatcttcttggagcctgc
accattggagggcccaccctggtcattacagaatattgttgctatggtgatcttttgaat
tttttgagaagaaaacgtgattcttttatttgttcaaagcaggaagatcatgcagaatct
gcactttataagaatcttctgcattcaaaggagtcttcctgcagcgatagtactaatgag
tacatggacatgaaacctggagtttcttatgtcgtcccaaccaaggctgacaaaaggaga
tctgcgagaataggctcatatatagaaagagatgtgacacccgccatcatggaggatgac
gagttggctttagacttagaagacttgctgagcttttcttaccaggtggcaaagggcatg
gctttccttgcctccaagaattgtattcacagagacttggcagccagaaatatcctcctt
actcatggtcggatcacaaagatttgtgattttggcctagccagagacatcaagaatgat
tctaattatgtggttaaaggaaatgctcgactacctgtgaagtggatggcacctgaaagc
attttcaactgtgtgtacacatttgaaagtgacgtctggtcctatgggatttttctttgg
gagctattctctttaggaagcagcccctatcctggaatgccagtcgattctaaattctac
aagatgatcaaggaaggcttccggatgctcagccctgaacatgcacctgctgaaatgtat
gacataatgaagacttgctgggatgcggatcccctaaaaagaccaacattcaagcaaatt
gttcagctaattgagaagcagatttcagagagcaccaatcatatttactccaacttagca
aactgcagccccaaccgacagaagcctgtagtggaccattccgtgcggatcaattctgtc
ggcagcaccgcttcctcctcccaacctctgcttgtgcacgacgacgtctga

KEGG   Macaca mulatta (rhesus monkey): 697002
Entry
697002            CDS       T01028                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    697002 (PDGFRA)
   04014 Ras signaling pathway
    697002 (PDGFRA)
   04015 Rap1 signaling pathway
    697002 (PDGFRA)
   04630 JAK-STAT signaling pathway
    697002 (PDGFRA)
   04020 Calcium signaling pathway
    697002 (PDGFRA)
   04072 Phospholipase D signaling pathway
    697002 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    697002 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    697002 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    697002 (PDGFRA)
   04540 Gap junction
    697002 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    697002 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    697002 (PDGFRA)
   05206 MicroRNAs in cancer
    697002 (PDGFRA)
   05230 Central carbon metabolism in cancer
    697002 (PDGFRA)
   05231 Choline metabolism in cancer
    697002 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    697002 (PDGFRA)
   05218 Melanoma
    697002 (PDGFRA)
   05215 Prostate cancer
    697002 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    697002 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    697002 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    697002 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    697002 (PDGFRA)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     697002 (PDGFRA)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   697002 (PDGFRA)
CD molecules [BR:mcc04090]
 Proteins
  697002 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 697002
NCBI-ProteinID: XP_014994177
Ensembl: ENSMMUG00000017395
UniProt: G7MTB0 A0A5F8AGH5
LinkDB
Position
5
AA seq 1089 aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYNSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKRVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVQAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGMPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHPRD
RSTVEGLVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADDSTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatccggcgttcctggtcttaggctgtcttctcacagggctgagccta
atcctctgccagctttcgttaccctctatccttccaaatgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaactctgatgtggaaatcagaaatgaagaaaacaacagtggcctt
tttgtgacagtcttggaagtgagcagtgcctcggcggcccacacagggctgtacacttgc
tattacaaccacactcagacagaagagaatgagcttgaaggcaggcacatttacatctat
gtgccagacccagatgtagcctttgtacctctaggaatgacggattatttagtcatcgtg
gaggacgatgattctgccatcataccttgtcgcacaactgatcctgagactcctgtaact
ttacacaacagtgagggggtggtacctgcctcctacaacagcagacagggctttaatggg
accttcactgtagggccctatatctgtgaggccaccgtcaaaggaaagaagttccagacc
atcccatttaacgtttatgctttaaaagcaacatcagagctggatctagaaatggaagct
cttaaaaccgtgtataagtcaggggaaacgattgtggtcacctgtgctgtttttaacaat
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaagaaatcaaagtcccatccatcaaattggtgtacactttgacggtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggctaccagggaggtcaaa
gaaatgaagagagtcactatttctgtccatgagaaagggttcattgaaatcaaacccacc
tttagccagttggaagctgtcaacctgcatgaagtcaaacattttgtcgtagaggtgcag
gcctacccacctcccaggatatcctggctgaaaaacaatctgactctgattgaaaacctc
acggagatcaccactgatgtggaaaagattcaggaaataaggtatcgaagcaaattaaag
cttatccgtgctaaggaagaagacagtggccattatactattgtagctcaaaatgaagat
gatgtgaagagctatacttttgaactgttaactcaagttccttcatccattctggacttg
gtcgatgatcaccatggctcaactgggggacagacggtgaggtgcacagctgaaggcatg
ccacttcctgatattgagtggatgatatgcaaggatattaagaaatgtaataatgaaact
tcctggacgattttggccaacaatgtctcaaacatcatcacggagatccacccccgagac
aggagtaccgtggagggccttgtgacttttgccaaagtggaagagaccattgcggtgaga
tgcctggctaagaatctccttggagctgagaaccgagagctgaagctggtggctcccacc
ctgcgttctgaactcacggtggctgccgcagtcctggtgctgctggtgattgtgatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagcccagatggacatgaatatatttatgtggacccaatgcagctg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgggtcttgggg
tctggagcgtttgggaaggtggttgaaggaacagcctatggattaagccggtcccaacct
gtcatgaaagttgcagtgaagatgctaaaacccacggccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccacatttgaacattgtaaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcacagagtactgcttctacgga
gatttggtcaactatttgcataagaatagggatagcttcctgagccgccacccagagaag
ccaaagaaagagctggatatctttgggttgaaccctgctgatgacagcacacggagctat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgatactaca
cagtatgtccctatgctagaaaggaaagaggtttctaaatattccgacatccagagatca
ctgtatgatcgtccagcctcatataagaagaaatctatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggccttactttgttggatttgttgagcttcacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgggatctggct
gctcgcaacgtcctcctggcacaaggaaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactatgtgtcgaaaggcagtacctttctgcccgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacactgagtgatgtctggtct
tacggcattctgctctgggagatcttttcccttggtggtactccttaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccat
gctaccagtgaagtctacgagatcatggtgaaatgctggaacagtgagccagagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaaaattcacctggacttcctgaagagtgaccatcctgctgtggcacgcatg
cgtgtggactcagacaatgcgtacattggtgtcacctacaaaaatgaggaagacaagctg
aaggactgggagggtggtctggatgagcagagactgagcgctgacagcggctacatcatt
cctctgcctgacattgaccctgtccctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccattgagacgggttccagcagttccaccttcatc
aagagagaggacgagaccattgaagacatcgacatgatggacgacatcggcatagactct
tcagacctggtggaagacagcttcctgtaa

KEGG   Macaca mulatta (rhesus monkey): 697573
Entry
697573            CDS       T01028                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X1
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04020  Calcium signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04530  Tight junction
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05215  Prostate cancer
mcc05219  Bladder cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    697573 (ERBB2)
   04012 ErbB signaling pathway
    697573 (ERBB2)
   04066 HIF-1 signaling pathway
    697573 (ERBB2)
   04020 Calcium signaling pathway
    697573 (ERBB2)
   04151 PI3K-Akt signaling pathway
    697573 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    697573 (ERBB2)
   04520 Adherens junction
    697573 (ERBB2)
   04530 Tight junction
    697573 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    697573 (ERBB2)
   05206 MicroRNAs in cancer
    697573 (ERBB2)
   05205 Proteoglycans in cancer
    697573 (ERBB2)
   05230 Central carbon metabolism in cancer
    697573 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    697573 (ERBB2)
   05226 Gastric cancer
    697573 (ERBB2)
   05219 Bladder cancer
    697573 (ERBB2)
   05215 Prostate cancer
    697573 (ERBB2)
   05213 Endometrial cancer
    697573 (ERBB2)
   05224 Breast cancer
    697573 (ERBB2)
   05223 Non-small cell lung cancer
    697573 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    697573 (ERBB2)
   01524 Platinum drug resistance
    697573 (ERBB2)
   01522 Endocrine resistance
    697573 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    697573 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    697573 (ERBB2)
   04090 CD molecules [BR:mcc04090]
    697573 (ERBB2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     697573 (ERBB2)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   697573 (ERBB2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   697573 (ERBB2)
CD molecules [BR:mcc04090]
 Proteins
  697573 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 697573
NCBI-ProteinID: XP_001090430
Ensembl: ENSMMUG00000001348
LinkDB
Position
16
AA seq 1255 aa
MELAAWYRWGLLLALLPPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG
DLLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPVCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLRVFETLEEITGYLYISAWPDSLP
DLSVLQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTRLCFVHTV
PWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARC
PSGVKPDLSYMPIWKFPDEEGTCQSCPINCTHSCVDLDDKGCPAEQRASPLTSIISAVVG
ILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGTGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPRAPSEG
TGSDVFDGDLGMGAAKGLQSLPAHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPEYV
NQPDVRPQPPSPQEGPLSPARPTGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAPR
GGAAPQPHLPPAFSPAFDNLYYWDQDPSERGAPPSTFKGTPTAENPEYLGLDVPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtaccgctgggggctcctcctcgccctcttgccccccggagct
gcgggcacccaagtgtgcaccggcacagacatgaagctgcggctccctgccagtcccgag
acccacctggacatgctccgccacctctaccagggctgccaggtggtgcagggtaacctg
gaactcacctacctgcccaccaatgccagcctctccttcctgcaggatatccaggaggtg
cagggctacgtgctcatcgctcacaaccaagtgaggcaggtcccactgcagaggctgcgg
attgtgcgaggcacccagctctttgaggacaactatgccctggccgtgctagacaatgga
gacctgctgaacaataccacccctgtcacaggggcctccccaggaggcctgcgggagctg
cagcttcgaagcctcacagagatcttgaaaggaggggtcttgatccagcggaacccccag
ctctgctaccaggacacgattttgtggaaggacatcttccataagaacaaccagctggct
ctcacactgatcgacaccaaccgctctcgggcctgccacccctgttctccagtgtgtaag
ggctcccgctgctggggagagagttctgaggattgtcagagcctgacgcgcactgtctgt
gccggtggctgtgcccgctgcaaggggccactgcccactgactgctgccatgagcagtgt
gctgccggctgcacgggccccaagcactctgactgcctggcctgcctccacttcaaccac
agcggcatctgtgaactgcactgcccagccctggtcacctacaacacagacacctttgag
tccatgcccaaccccgagggccggtatacattcggcgccagctgtgtgactgcctgtccc
tacaactacctttctacggacgtgggatcctgcaccctcgtctgccccctgcacaaccaa
gaggtgacagcggaggacggaacacagcgatgtgagaagtgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggagcacttgcgagaggtgagggcggtcaccagtgccaat
atccaggagtttgctggctgcaagaagatctttgggagcttggcatttctgccagagagc
tttgatggcgacccagcctccaacaccgccccgcttcagccggagcagctccgagtgttt
gagactctggaagagatcacaggttacctatacatctcagcatggccagacagcctgcct
gaccttagcgtcctccagaacctgcaagtaatccggggacgaattctgcacaatggcgcc
tactcactgaccctgcaagggctgggcatcagctggctggggctgcgctcgctgagggaa
ctgggcagtggactggccctcatccaccataacacccgcctctgctttgtgcacacggtg
ccctgggaccagctcttccggaacccgcaccaagccctgctccacactgccaaccggcca
gaggacgagtgtgtgggcgagggcctggcctgccaccagctgtgcgcccgagggcactgc
tggggtccagggcccacccagtgtgtcaactgcagccagttccttcggggccaggagtgc
gtggaggaatgccgagtactgcaggggctccccagggagtatgtgaatgccagacactgt
ttgccgtgccaccctgagtgtcagccccagaatggctcagtgacatgttttggaccggag
gctgaccagtgtgtggcctgtgcccactataaggaccctcccttctgcgtggcccgctgc
cccagcggtgtgaaacctgacctctcctacatgcccatctggaagtttccagatgaggag
ggcacgtgccagtcttgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccccgccgagcagagagccagccctctgacgtccatcatctctgctgtggtgggc
attctgctggtcgtggtcttgggggtggtctttggaatcctcatcaagcgacggcagcag
aagatccggaagtacacgatgcggaggctgctgcaggaaacggagctggtggagccactg
acaccgagtggagcgatgcccaaccaggcgcagatgcggatcctgaaagagacggagctg
aggaaggtgaaggtgcttggatctggagcttttggcacagtctacaagggcatctggatc
cctgatggggagaatgtgaaaattccagtggccatcaaagtgttgagggaaaacacatcc
cccaaagccaacaaagaaatcttagacgaagcatatgtgatggctggtgtgggctcccca
tatgtctcccgcctcctgggcatctgcctgacatccacggtgcagctggtgacacagctt
atgccctatggctgcctcttagaccatgtccgagaaaaccgcggacgcctgggctcccag
gacctgctgaactggtgtatgcagattgccaaggggatgagctacctggaggatgtgcgg
ctcgtacacagggacttggctgctcggaacgtgctggtcaagagtcccaaccatgtcaaa
attacagactttgggctggctcggctgctggacattgacgagacagagtaccatgcagat
gggggcaaggtgcccatcaagtggatggcgctggagtccattctccgacggcggttcacc
caccagagtgatgtgtggagttatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttacgatgggatcccagcccgggagatccctgacctgctggaaaagggggagcgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccgagattccgggagttggtgtcggaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaatgaggacttgggcccagccagtcccttg
gacagcaccttctaccgctcactgctggaggacgatgacatgggggacctggtggatgct
gaggagtatctggtaccccagcagggcttcttctgtccagaccctgccccgggcactggg
ggcatggtccaccacaggcaccgcagctcatctaccaggagtggcggtggggacctgacg
ctagggctggagccctctgaagaggaggcccccaggtctccacgggcaccctccgaaggg
actggctctgatgtatttgatggtgacctaggaatgggggcagccaaggggctgcaaagc
ctccccgcacatgaccccagccctctacagcggtacagtgaggaccccacggtacccctg
ccttctgagactgacggctacgttgcccccctgacctgcagtccccagcccgaatatgtg
aaccagccagatgttcggccacagcccccttcgccccaagagggccctctgtctcctgcc
cgacctactggtgccactctggaaaggcccaagactctctccccagggaagaatggggtt
gtcaaagacgtttttgcctttgggggtgctgtggagaaccccgagtacttggcaccccgg
ggaggagctgcccctcagccccaccttcctcctgccttcagcccagccttcgacaacctc
tattactgggaccaggacccatcagagcggggggctccacctagcaccttcaaagggaca
cctacggcagagaacccagagtacctgggtctggacgtgccagtgtga

KEGG   Macaca mulatta (rhesus monkey): 698293
Entry
698293            CDS       T01028                                 

Gene name
KDR
Definition
(RefSeq) vascular endothelial growth factor receptor 2
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04370  VEGF signaling pathway
mcc04510  Focal adhesion
mcc05205  Proteoglycans in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    698293 (KDR)
   04014 Ras signaling pathway
    698293 (KDR)
   04015 Rap1 signaling pathway
    698293 (KDR)
   04370 VEGF signaling pathway
    698293 (KDR)
   04020 Calcium signaling pathway
    698293 (KDR)
   04151 PI3K-Akt signaling pathway
    698293 (KDR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    698293 (KDR)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    698293 (KDR)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    698293 (KDR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    698293 (KDR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    698293 (KDR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    698293 (KDR)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     698293 (KDR)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   698293 (KDR)
CD molecules [BR:mcc04090]
 Proteins
  698293 (KDR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig V-set VEGFR-2_TMD C2-set_2 Ig_4
Other DBs
NCBI-GeneID: 698293
NCBI-ProteinID: XP_014994176
Ensembl: ENSMMUG00000012669
UniProt: F7E313
LinkDB
Position
5
AA seq 1356 aa
MASKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLD
WLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGVELSVGE
KLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPVKYLGYPPP
EIKWYKNGIPLESNHTVKVGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECPNEPSQAVSVTNPY
PCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGE
RVISFHVTRGPEITLQPDLQPTEQESVSLWCTADKSTFENLTWYKLGPQPLPVHVGELPT
PVCKNLDTLWKLNATIFSNSTNDILIMELKNASLQDQGDYVCVAQDRKTKKRHCVVRQLT
VLERVAPMITGNLENQTTSIGETIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNR
NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWL
LLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLK
RRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLA
SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
GMVLASEELKTLEDRTKLAPSFSGMVSSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYS
SEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV
NT seq 4071 nt   +upstreamnt  +downstreamnt
atggcgagcaaggtgctgctggccgtcgccctgtggctctgcgtggagacccgggccgcc
tctgtgggtttgcctagtgtttctcttgatctgcccaggctcagcatacaaaaagacata
cttacaattaaggctaatacaactcttcaaattacttgcaggggacagagggacttggac
tggctttggcccaataatcagagtggcagtgagcaaagggtggaggtgactgagtgcagc
gatggcctcttctgtaagacactcacaattccaaaagtgatcggaaatgacactggagcc
tacaagtgcttctaccgggaaactgacttggcctcggtcatttatgtctatgttcaagat
tacagatctccatttattgcttctgttagtgaccaacatggagtcgtgtacattactgag
aacaaaaacaaaactgtggtgattccatgtctcgggtccatttcaaatctcaacgtgtca
ctttgtgcaaggtacccagaaaagagatttgttcctgatggtaacagaatttcctgggac
agcaagaagggctttactattcccagctatatgatcagctatgctggcatggtcttctgt
gaagcaaaaattaatgatgaaagttaccagtctattatgtacatagttgtggttgtaggg
tataggatttatgatgtggttctgagtccgtctcatggagttgaactatctgttggagag
aagcttgtcttaaattgtacagcaagaactgaactaaatgtggggattgacttcaactgg
gaatacccttcttcgaagcatcagcataagaaacttgtaaaccgagatctaaaaacccag
tctgggagtgagatgaagaaatttttgagcaccttaactatagatggtgtaacccggagt
gaccaaggattgtacacctgtgcagcgtccagtgggctgatgaccaagaagaacagcaca
tttgtcagggtccatgaaaaaccttttgttgcttttggaagtggcatggaatctctggtg
gaagccacggtgggggagcgtgtcagaatccctgtgaagtaccttggttacccgccccca
gaaataaaatggtataaaaatggaataccccttgagtccaatcacacagttaaagtgggg
catgtgctgacgatcatggaagtgagcgaaagagacacaggaaattacactgtcatcctt
accaatcccatttcaaaggagaagcagagtcacgtggtctctctggttgtgtatgtccca
ccccagattggtgagaaatctctgatctctcctgtggattcctaccagtacggcaccact
caaacgctgacatgtacggtctacgctattcctcccccgcatcacatccactggtattgg
cagttggaggaagagtgccccaacgagcccagccaagctgtctcagtgacaaacccatac
ccttgtgaagaatggagaagtgtggaggacttccagggaggaaataaaattgaagtcaat
aaaaatcaatttgctctaattgaaggaaaaaacaaaactgtaagtacccttgttatccaa
gcggcaaatgtgtcagctttgtacaaatgtgaagcggtcaacaaagtcgggagaggagag
agggtgatctccttccatgttaccaggggtcctgaaattactttgcaacctgacttgcag
cccactgaacaggagagcgtgtctttgtggtgcactgcagacaaatctacatttgagaac
ctcacatggtacaagcttggcccacagcctctgccagtccacgtgggagagttgcccaca
cctgtttgcaagaacttggatactctttggaaattgaatgccactatattctctaatagc
acaaatgacattttgatcatggagcttaagaatgcatccttgcaggaccaaggagactat
gtctgcgttgctcaagacaggaagaccaagaaaagacattgcgtggtcaggcagctcaca
gtcctcgagcgcgtggcacccatgatcacaggaaacctggagaatcagacgacgagtatt
ggggaaaccattgaagtctcatgcacggcatctgggaatccccctccacagatcatgtgg
tttaaagataatgagacccttgtagaagactcaggcattgtattgaaggatgggaaccgg
aacctcactatccgcagagtgaggaaggaggacgaaggcctctacacctgccaggcatgc
agtgttcttggctgtgcaaaagtggaggcatttttcataatagaaggtgcccaggaaaag
acgaacttggaaatcattattctagtaggcacagcagtgattgccatgttcttctggcta
cttcttgtcatcattctacggaccgttaagcgggccaatggaggggaactgaagacaggc
tacttgtccatcgtcatggatcctgatgaactcccattggatgaacactgtgaacgactg
ccttatgatgccagcaaatgggaattccccagagaccggctgaagctaggtaagccgctt
ggccgtggtgcctttggccaagtgattgaagcagatgcctttggaattgacaagacagca
acttgcaggacagtagcagtcaaaatgttgaaagaaggagcaacacacagtgagcatcga
gccctcatgtctgaactcaagatcctcattcatattggtcaccatctcaatgtggtcaac
cttctaggtgcctgtaccaagccaggagggccactcatggtgattgtggaattctgcaag
tttggaaacctatccacttacctgaggagcaagagaaatgaatttgtcccctacaagacc
aaaggggcacgattccgtcaagggaaagactatgttggagcaatccctgtggatctgaaa
cggcgcttggacagcatcaccagtagccagagctcagccagctctggatttgtggaggag
aagtccctcagtgatgtagaagaagaggaagctcctgaagacctgtataaggacttcctg
accttggagcatctcatctgttacagcttccaagtggctaagggcatggagttcttggca
tcacgaaagtgtatccacagggacctggcggcacgaaatatcctcttatcggagaagaac
gtggttaaaatctgtgactttggcttggcccgggatatttataaagatccagattatgtc
agaaaaggagatgctcgcctccctttgaaatggatggccccagaaacaatttttgacaga
gtgtacacaatccagagtgacgtctggtcttttggcgtgttgctgtgggaaatattttcc
ttgggtgcttctccatatcctggggtaaagattgatgaagaattttgtaggcgattgaaa
gaaggaactagaatgagggcccccgattatactacaccagaaatgtaccagaccatgctg
gactgctggcacggggagcccagtcagagacccacgttttcagagttggtggaacatttg
ggaaatctcttgcaagctaatgctcagcaggacggcaaagactatattgttcttccgata
tcagagactttgagcatggaagaggattctggactctctctgcctacctcacctgtttcc
tgtatggaggaggaggaagtatgtgaccccaaattccattatgacaacacagcaggaatc
agtcagtatctgcagaacagtaagcgaaagagccggcctgtgagtgtaaaaacatttgaa
gacatcccattagaagaaccagaagtaaaagtaatcccagatgacaaccagacggacagt
ggtatggttcttgcctcagaagagctgaaaactttggaagacagaaccaaattagctcca
tcttttagtggaatggtgtccagcaaaagcagggagtctgtggcatctgagggctcaaac
cagacaagtggctaccagtccggatatcactccgacgacacagacaccactgtgtactcc
agtgaggaagcagaacttttaaagctgatagagatcggagtgcaaaccggcagcacagcc
cagattctccagcctgactcggggaccacattgagctcccctcctgtttaa

KEGG   Macaca mulatta (rhesus monkey): 698494
Entry
698494            CDS       T01028                                 

Gene name
FGFR4
Definition
(RefSeq) fibroblast growth factor receptor 4
  KO
K05095  fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04810  Regulation of actin cytoskeleton
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    698494 (FGFR4)
   04014 Ras signaling pathway
    698494 (FGFR4)
   04015 Rap1 signaling pathway
    698494 (FGFR4)
   04020 Calcium signaling pathway
    698494 (FGFR4)
   04151 PI3K-Akt signaling pathway
    698494 (FGFR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    698494 (FGFR4)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    698494 (FGFR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    698494 (FGFR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    698494 (FGFR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    698494 (FGFR4)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    698494 (FGFR4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     698494 (FGFR4)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   698494 (FGFR4)
CD molecules [BR:mcc04090]
 Proteins
  698494 (FGFR4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set Ig_2 ig V-set C2-set_2
Other DBs
NCBI-GeneID: 698494
NCBI-ProteinID: XP_014996982
Ensembl: ENSMMUG00000004919
LinkDB
Position
6
AA seq 802 aa
MRLLSALLGVLLSVPGPPVLSLEASEEVELEPCLAPSMEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARASMIVLQNLTLTIDDS
LTSSNDDEDPQSHRDSSNGHIYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDLTWTA
ATPEARYTDVILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPQSSEGPLAFPVLVSCAYQVARGM
QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGIHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPAGGDTSSTCSSSDS
VFSHDPLPLGSSSFPFGSGVQT
NT seq 2409 nt   +upstreamnt  +downstreamnt
atgcggctgctgtcggccctcttgggggtcctgctgagtgtgcctgggcctccagtcttg
tccctggaggcctcggaggaagtggagctggagccctgcctggctcccagcatggagcag
caagagcaggagctgacagtagcccttgggcagcctgtgcggctgtgctgtgggcgggct
gagcgtggtggccactggtacaaggagggcagtcgcctggcacctgctggccgtgtacgg
ggctggaggggccgcctagagattgccagcttcctacctgaggatgctggccgctacctc
tgcctggcccgagcctccatgatcgtcctgcaaaatctcaccttgactatagatgactcc
ttgacctccagcaacgatgatgaggacccccagtcccatagggactcctcgaatgggcac
atttacccccagcaagcaccctactggacacacccccagcgcatggagaagaaactgcat
gcagtaccggctgggaacaccgtcaagttccgctgtccggctgcaggcaaccccacgccc
accatccgctggcttaaggatggacaggcctttcatggggagaaccgcattggaggcatt
cggctgcgccaccagcactggagtctcgtgatggagagcgtggtgccctcggaccgcggc
acatacacttgcctggtggagaacgctgtgggcagcatccgttataactacctgctggat
gtgctggagcggtccccgcaccggcccatcctgcaggctgggctcccggccaacaccaca
gccgtggtgggcagtgacgtggagctgctgtgcaaggtgtacagcgatgcccagccccac
atccagtggctgaagcacatcgtcatcaacggcagcagcttcggggccgacggcttcccc
tatgtgcaagtcctgaagactgcagacatcaatagctcagaggtggaggtcctgtacctg
cggaacgtgtcagccgaggacgcaggcgagtacacctgccttgcaggcaattccatcggc
ctctcctaccagtctgcctggctcacggtgctgccagaggaggacctcacatggaccgca
gcaacgcccgaggccaggtatacggacgtcatcctgtacgcgtcgggctccctggccttg
gctgtgctcctgctgctggccgggctgtatcgagggcaggcgctccacggccggcacccc
cgcccacccgccaccgtgcagaagctctcccgcttccctctggcccgacagttctccctg
gagtcaggctcttccggcaagtcaagctcatccctggtgcgaggcgtgcgtctctcctcc
agcggccccgccttgctcgccggcctcgtgagtctagacctacctctcgacccactgtgg
gagttcccccgggacaggctggtgcttgggaagcccctgggcgagggctgctttggacag
gtagtacgtgcagaggcctttggcatggaccctgcccggcctgaccaagccagtactgtg
gctgtcaagatgctcaaagacaacgcctctgacaaggacctggctgacctggtctcggag
atggaggtgatgaagctgattggccgacacaagaacatcatcaacctgctgggtgtctgc
acccaggaagggcccctgtatgtaatcgtggagtgcgctgccaagggaaaccttcgggag
ttcctgcgggcccggcgccccccgggccctgacctcagcccggacggtcctcagagcagt
gaggggccactcgccttcccagtcctggtctcctgcgcctaccaggtggcccgaggcatg
cagtatctggagtcccggaagtgtatccaccgggacctggctgcccgcaatgtgctggtg
acggaggacaatgtgatgaagatagctgactttgggctggcccgtggcatccaccacatt
gactactataagaaaaccagcaacggccgcctgcctgtcaagtggatggcgcccgaggcc
ttgtttgaccgagtgtacacacaccagagtgacgtgtggtcttttggggtcctgctgtgg
gagatcttcaccctcgggggctccccgtatcctggcatcccggtggaggagctgttctca
ctgctgcgggagggacatcggatggaccgacccccacactgccccccagagctgtacggg
ctgatgcgtgagtgctggcatgcggcaccctcccagaggcccaccttcaagcagctggtg
gaggcgctggacaaggtcttactggccgtctctgaggagtacctcgacctccgcctgacc
ttcggaccctattcccctgctggtggggacaccagcagcacctgctcctccagtgactcc
gtcttcagccacgaccccctgccactgggatccagctccttcccctttgggtctggggtg
cagacatga

KEGG   Macaca mulatta (rhesus monkey): 700126
Entry
700126            CDS       T01028                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1 precursor
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04520  Adherens junction
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04714  Thermogenesis
mcc04810  Regulation of actin cytoskeleton
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05224  Breast cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    700126 (FGFR1)
   04014 Ras signaling pathway
    700126 (FGFR1)
   04015 Rap1 signaling pathway
    700126 (FGFR1)
   04020 Calcium signaling pathway
    700126 (FGFR1)
   04151 PI3K-Akt signaling pathway
    700126 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    700126 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    700126 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    700126 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    700126 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    700126 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    700126 (FGFR1)
   05205 Proteoglycans in cancer
    700126 (FGFR1)
   05230 Central carbon metabolism in cancer
    700126 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    700126 (FGFR1)
   05215 Prostate cancer
    700126 (FGFR1)
   05224 Breast cancer
    700126 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    700126 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    700126 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    700126 (FGFR1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     700126 (FGFR1)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   700126 (FGFR1)
CD molecules [BR:mcc04090]
 Proteins
  700126 (FGFR1)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   700126 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 FGFR3_TM V-set C2-set_2 Ig_6 Pkinase_fungal DUF1615
Other DBs
NCBI-GeneID: 700126
NCBI-ProteinID: NP_001253576
Ensembl: ENSMMUG00000022478
UniProt: H9FRD4
LinkDB
Position
8
AA seq 731 aa
MWSWKCLLFWAVLVTATLCTARPSPTLPEQDALPSSEDDDDDDDSSSEEKETDNTKPNPV
APYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYA
TWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGS
NVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNV
SFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMV
GSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSS
SGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKV
AVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLRE
YLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLV
TEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLW
EIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLV
EDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHP
AQLANGGLKRR
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacgctctgcacc
gctaggccgtccccgaccttgcctgaacaagatgctctcccctcctcagaggatgatgat
gatgatgatgactcctcttcagaggagaaagagacagataacaccaaaccaaaccccgta
gctccatattggacatccccagaaaagatggaaaagaaattgcatgcggtgccagctgcc
aagacagtgaagttcaaatgcccttccagtgggaccccaaaccccacactgcgctggttg
aaaaatggcaaagaattcaaacctgaccacaggattggaggctacaaggtccgttatgcc
acctggagcatcataatggactccgtggtgccctctgacaagggcaactacacctgcatt
gtggagaatgagtatggcagcatcaaccacacctaccagctggatgtcgtggagcggtcc
cctcaccggcccatcctgcaagcagggttgcccgccaacaagacagtggccctgggtagc
aacgtggagttcatgtgtaaggtgtacagtgacccacagccgcatatccagtggctaaag
cacatcgaggtgaacgggagcaagattggtccagacaacctgccttatgtccagatcttg
aagactgctggagttaataccaccgacaaagagatggaggtgcttcacttaagaaatgtc
tcctttgaggacgcaggggagtatacgtgcttggcgggtaactctatcggactctcccat
cactctgcatggttgaccgttctggaagctctggaagagaggccggcggtgatgacctcg
cccctgtacctggagatcatcatctattgcacaggggccttcctcatctcctgcatggta
gggtcggtcatcgtctacaagatgaagagtggcaccaagaagagcgacttccacagccag
atggctgtgcacaagctggccaagagcatccctctgcgcagacaggtaacagtgtctgct
gactccagtgcgtccatgaactctggggttcttctggttcggccatcacggctctcctcc
agtgggactcccatgctagcaggggtctccgagtatgagcttcctgaagaccctcgctgg
gagctgcctcgggacagactggtcttaggcaaacccctgggagagggctgctttgggcag
gtggtgttggcagaggccatcgggttggacaaggacaaacccaaccgtgtgaccaaagtg
gctgtgaagatgttgaagtcggacgcaacagagaaagacttgtcagacctgatctcagaa
atggagatgatgaagatgatcgggaagcataagaatatcatcaacctgctgggggcctgc
acgcaggacggtcccttgtatgtcatcgtggagtatgcctccaagggcaacctgcgggag
tacctgcaggcccggaggcccccggggctggaatactgctacaaccccagccacaaccca
gaggagcagctctcctccaaggacctggtgtcctgcgcctatcaggtggcccgaggcatg
gagtatctggcctccaagaagtgcatacaccgagacctggccgccaggaatgtcctggtg
acagaggacaatgtgatgaagatagcagactttggcctcgcacgggacattcaccacatc
gactactataaaaagacaaccaacggtcgactgcctgtgaagtggatggcgcccgaggca
ttgtttgaccggatctacacccaccagagtgatgtgtggtctttcggggtgcttctgtgg
gagatcttcactctgggcggctccccataccctggtgtgcctgtggaggagcttttcaag
ctgctgaaggagggtcaccgcatggacaagcccagtaactgcaccaacgagctgtacatg
atgatgcgggactgctggcatgcagtgccctcacagagacccaccttcaagcagctggtg
gaagacctggaccgcatcgtggccttgacctccaaccaggagtacctggacctgtccatg
cccctggaccagtactccccgagctttcccgacacccggagctctacatgctcctcaggg
gaggattccgtcttctctcatgagccgctgcccgaggagccctgcctgccccgacaccca
gcccagcttgccaatggcggactcaaacgccgctga

KEGG   Macaca mulatta (rhesus monkey): 704562
Entry
704562            CDS       T01028                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor precursor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc05100  Bacterial invasion of epithelial cells
mcc05144  Malaria
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05211  Renal cell carcinoma
mcc05218  Melanoma
mcc05223  Non-small cell lung cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    704562 (MET)
   04014 Ras signaling pathway
    704562 (MET)
   04015 Rap1 signaling pathway
    704562 (MET)
   04020 Calcium signaling pathway
    704562 (MET)
   04151 PI3K-Akt signaling pathway
    704562 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    704562 (MET)
   04520 Adherens junction
    704562 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    704562 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    704562 (MET)
   05202 Transcriptional misregulation in cancer
    704562 (MET)
   05206 MicroRNAs in cancer
    704562 (MET)
   05205 Proteoglycans in cancer
    704562 (MET)
   05230 Central carbon metabolism in cancer
    704562 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    704562 (MET)
   05226 Gastric cancer
    704562 (MET)
   05218 Melanoma
    704562 (MET)
   05211 Renal cell carcinoma
    704562 (MET)
   05223 Non-small cell lung cancer
    704562 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    704562 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    704562 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    704562 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    704562 (MET)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     704562 (MET)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  MET family
   704562 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema TIG Pkinase PSI Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 704562
NCBI-ProteinID: NP_001162100
Ensembl: ENSMMUG00000006779
UniProt: G7MM61
LinkDB
Position
3
AA seq 1381 aa
MKAPAVLVPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETAIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPNQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPHHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYIHAFESNNFIYFLTVQRETLNAQTFHTRIIRFCSLNSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRAEF
TTALQRVDLFMGQFSEVLLTSISTFVKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHPLNQNGYTLVVTGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECPSGTWTQQICLPAIYKVFPTSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPIIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLHSVSVPRMVINVH
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISIALLLLLGLFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
T
NT seq 4146 nt   +upstreamnt  +downstreamnt
atgaaggcccccgctgtgcttgtacctggcatcctcgtgctcctgtttaccttggtgcag
aggagcaatggggagtgtaaagaggcactagcaaagtccgagatgaatgtgaatatgaag
tatcagcttcccaacttcaccgcggaaacagccatccagaatgtcattctacatgagcat
cacattttcctcggtgccaccaactacatttatgttttaaatgaggaagaccttcagaag
gttgctgagtacaagaccgggcctgtgctggaacacccagattgtttcccgtgtcaggac
tgcagcagcaaagccaatttatcaggaggcgtttggaaagataacatcaacatggctctg
gttgtcgacacctactatgatgatcaactcattagctgtggcagcgtcaacagagggacc
tgccagcgacatgtctttccccataatcatactgctgacatacagtcggaggttcactgc
atattctccccacagatagaagagcccaaccagtgccctgactgtgtggtgagcgccctg
ggagccaaagtcctttcatctgtaaaggaccggttcatcaacttctttgtaggcaatacc
ataaattcttcttatttcccacatcatccgttgcattcgatatcagtgagaaggctaaag
gaaacgaaagatggttttatgtttttgacggaccagtcctacattgatgttttacctgag
ttcagagattcttaccccattaagtacatccatgcttttgaaagcaacaattttatttac
ttcttgacggtccaaagggaaactctaaatgctcagacttttcacacaagaataatcagg
ttctgttccttaaactctggattgcactcctacatggaaatgcctctagagtgtattctc
acagaaaagagaaaaaagagatccacaaagaaggaagtgtttaatatccttcaggctgca
tatgtcagcaagcccggggcccagcttgctagacaaataggagccagcctgaatgatgac
attctctttggggtgttcgcacaaagcaagccagattctgccgaaccaatggatcgatct
gcaatgtgtgcattccctatcaaatatgtcaacgacttcttcaacaagatcgtcaacaaa
aacaatgtgagatgtctccagcatttttatggacccaatcatgagcactgttttaatagg
acacttctgagaaattcatcaggctgtgaagcgcgccgtgatgaatatcgagcagagttt
accacagctttgcagcgcgttgacttattcatgggtcaattcagcgaagtcctcttaaca
tctatatccaccttcgtgaaaggagacctcaccatcgctaatcttgggacatcagagggt
cgcttcatgcaggttgtggtttctcgatcaggaccatcaacccctcatgtgaattttctc
ctggactctcacccggtgtctccagaagtgattgtggagcatccattaaaccagaatggc
tacacactggttgtcacggggaagaagatcaccaagatcccattgaatggcttgggctgc
agacatttccagtcctgcagtcagtgcctctctgccccaccctttgtgcagtgtggctgg
tgccacgacaaatgtgtgcgatcggaggagtgccccagtgggacatggactcaacagatc
tgtctgcctgcaatctacaaggttttcccaactagtgcaccccttgaaggagggacaaga
ctgaccatatgtggctgggactttggatttcggaggaataataaatttgatttaaagaaa
actagagttctccttggaaatgagagctgcaccttgactttaagtgagagcacgatgaat
acattgaaatgcacagttggtcctgccatgaataaacatttcaatatgtccataattatt
tcaaatggccatgggacaacacaatacagtacattttcctatgtggatcctataataaca
agtatttcgccaaaatatggccctatggctggtggcactttacttactttaactggaaat
tacctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtactttaaaa
agtgtgtcaaacagtattctcgaatgttataccccagcccaaaccatttcaactgagttt
gctgttaaattgaaaattgacttagccaaccgagagacaagcatcttcagttaccgggaa
gaccccattgtctatgaaattcatccaaccaaatcttttattagtggtgggagcacaata
acaggtgttgggaaaaacctgcattcagttagtgtcccgaggatggtcataaatgtgcat
gaagcaggaaggaactttacagtggcatgtcagcatcgctctaattcagagataatctgc
tgtaccactccttccctgcaacagctgaatctgcaactccctctgaaaaccaaagccttt
ttcatgttagatgggatcctttccaaatactttgatctcatttatgtacataatcctgtg
tttaagccttttgaaaagccagtaatgatctcaatgggcaatgaaaatgtactggaaatt
aagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaataag
agctgtgagaatatacacttacattctgaagccgttttatgcacggtccccaatgacctg
ctgaaattgaacagcgagctaaatatagagtggaagcaagcaatttcttcaaccgtcctt
ggaaaagtaatagttcaaccagatcagaatttcaccggattgattgctggtgttgtctca
atatcaatagcactcttactactacttgggcttttcctgtggctgaaaaagagaaagcaa
attaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcatttg
gataggcttgtaagtgcccgaagtgtaagcccaacaacagaaatggtttcaaatgaatct
gtagactaccgagctacttttccagaagatcagtttcctaattcatctcagaacggttca
tgccgacaagtgcagtatcctctgacagacatgtcccccatcctgactagtggggactct
gatatatccagtccattactgcaaaacactgtccacattgacctcagcgctctaaatcca
gagctggtccaggcagtgcagcatgtagtgattgggcccagtagcctgattgtgcatttc
aatgaagtcataggaagagggcattttggttgtgtatatcatgggactttgttggacaat
gatggcaagaaaattcactgtgctgtgaaatccttgaacagaatcactgacataggagaa
gtttcccagtttctgaccgagggaatcatcatgaaagattttagtcatcccaatgtcctc
tcgctcctgggaatctgcctgcgaagtgaagggtctccgctggtggtcctaccctacatg
aaacatggagatcttcgaaatttcattcgaaatgagactcataatccaactgtaaaagat
cttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaagttt
gtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcacagtcaaggtt
gctgattttggtcttgccagagacatgtatgataaagaatactatagtgtgcacaacaaa
acaggtgcaaagctgccagtgaagtggatggctttggaaagtctgcaaactcaaaagttt
accaccaagtcagatgtgtggtcctttggtgtgctcctctgggagctcatgacaagagga
gccccaccctatcctgacgtgaacacctttgatataactgtttacttgttgcaagggaga
aggctcctacaacccgaatactgcccagaccccttatatgaagtaatgctaaaatgctgg
caccctaaagcagaaatgcgcccatccttttctgaactggtgtcccggatatcagcgatc
ttctctactttcattggggagcactacgtccatgtaaacgctacttatgtgaacgtaaaa
tgtgtcgctccatatccttctctgttgtcatcagaagataacgctgatgacgaggtggac
acatga

KEGG   Macaca mulatta (rhesus monkey): 706009
Entry
706009            CDS       T01028                                 

Gene name
INSR
Definition
(RefSeq) LOW QUALITY PROTEIN: insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04520  Adherens junction
mcc04910  Insulin signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04923  Regulation of lipolysis in adipocytes
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04960  Aldosterone-regulated sodium reabsorption
mcc05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    706009 (INSR)
   04014 Ras signaling pathway
    706009 (INSR)
   04015 Rap1 signaling pathway
    706009 (INSR)
   04066 HIF-1 signaling pathway
    706009 (INSR)
   04068 FoxO signaling pathway
    706009 (INSR)
   04072 Phospholipase D signaling pathway
    706009 (INSR)
   04022 cGMP-PKG signaling pathway
    706009 (INSR)
   04151 PI3K-Akt signaling pathway
    706009 (INSR)
   04152 AMPK signaling pathway
    706009 (INSR)
   04150 mTOR signaling pathway
    706009 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    706009 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    706009 (INSR)
   04923 Regulation of lipolysis in adipocytes
    706009 (INSR)
   04913 Ovarian steroidogenesis
    706009 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    706009 (INSR)
  09149 Aging
   04211 Longevity regulating pathway
    706009 (INSR)
   04213 Longevity regulating pathway - multiple species
    706009 (INSR)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    706009 (INSR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    706009 (INSR)
   04932 Non-alcoholic fatty liver disease
    706009 (INSR)
   04931 Insulin resistance
    706009 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    706009 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    706009 (INSR)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     706009 (INSR)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   706009 (INSR)
CD molecules [BR:mcc04090]
 Proteins
  706009 (INSR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like Insulin_TMD fn3 Kinase-like B2 DUF4476
Other DBs
NCBI-GeneID: 706009
NCBI-ProteinID: XP_028695354
Ensembl: ENSMMUG00000028907
LinkDB
Position
19
AA seq 1388 aa
MGTGGRRGTAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYXKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAF
PNTSSTSTPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYV
SARTCLKVGLLPQAKADDIVGPVTHEIFENNIVHLMWQEPKEPNGLIVLYEVSYRRYGDE
ELHLCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNI
AKIIIGPLIFVFLFSIVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPD
EWEVPREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNE
ASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRLPPTLQ
EMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGG
KGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGY
LDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPEN
EELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRIL
TLPRSNPS
NT seq 4167 nt   +upstreamnt  +downstreamnt
atgggcaccgggggccggcgggggacagctgccgcgccgctgctggtggcggtggccgcg
ctgctactgggcgccgcgggccacctgtaccccggagaggtgtgtcccggcatggatatc
cggaacaacctcaccaggttacacgagctggagaattgctctgtcatcgaaggacacttg
cagatactcttgatgttcaaaacgaggcccgaagatttccgggacctcagtttccccaaa
ctcataatgatcactgattacttgctgctcttccgggtctatgggctcgagagcctgaag
gacctgttccccaacctcacggtcatccggggatcacgactgttctttaactacgcgctg
gtcatcttcgagatggttcacctcaaggaacttggcctctacaatctaatgaacatcacc
cggggttctgtccgcatcgagaagaacaacgagctctgttacttggccactatcgactgg
tcccgcatcctggattccgtggaggataattacatcgtgttgaacaaagatgacaacgag
gagtgtggagacatctgtccgggtacagcgaagggcaagaccaactgccccgccactgtc
atcaatgggcagtttgtcgaacggtgttggactcatagtcactgccagaaagtttgccca
accatctgtaagtcacacggctgcactgccgaaggcctctgttgccacagcgagtgcctg
ggcaactgttctgagcccgacgaccccaccaagtgcgtggcctgccgcaacttctacctg
gacggcaggtgtgtggagacctgcccgcccccgtactaccacttccaggactggcgctgt
gtgaacttcagcttctgccaggacctgcaccacaaatgcaagaactcgcggaggcagggc
tgccaccagtacgtcattcataacaacaagtgcatccctgagtgtccctccgggtacacg
atgaattccagcaacttgctgtgcaccccgtgcctgggtccctgtcccaaggtatgccac
ctcctagaaggcgagaagaccatcgactcggtgacgtctgcccaggagctccgaggatgc
accgtcatcaacgggagtctgatcatcaacattcgaggaggcaataatctggcagctgag
ctagaagccaacctcggcctcattgaagaaatttcaggttatnctaaaatccgccgatcc
tacgctctggtgtcactttccttcttccggaagttacgtctgattcgaggagagaccttg
gaaatcgggaactattccttctatgccttggacaaccagaacctaaggcagctctgggac
tggagcaaacacaacctcacgatcactcaggggaaactcttcttccactataaccccaaa
ctctgcttgtcagaaatccacaagatggaagaagtttcaggaaccaaggggcgccaggag
agaaatgacattgccctgaagacaaatggggaccaggcatcctgtgaaaatgagttactt
aaattttcttacattcggacatctttcgataagatcttgctgagatgggagccgtactgg
ccccccgacttccgagacctcctggggttcatgctgttctacaaagaagccccttaccag
aatgtgacggagtttgatgggcaggatgcgtgtggttccaacagctggacggtggtagac
attgacccgcccctgaggtccaacgaccccaaatcacagaaccacccaggatggctaatg
cggggtctcaagccctggacccagtatgccatctttgtgaagaccctggtcaccttttcg
gatgaacgccggacctatggagccaagagtgacatcatttatgtccagacagatgccacc
aacccctccgtgcccctggatccaatctcagtgtctaactcatcatcccagattattctg
aagtggaaaccgccctccgaccccaatggcaacatcacccactacctggttttctgggag
aggcaggcggaagacagtgagctgttcgagctggattattgcctcaaagggctgaagctg
ccctcgaggacctggtctccaccattcgagtctgaagattctcagaagcacaaccagagt
gaatatgaggattcagccggtgaatgttgctcctgtccaaagacagactctcagatcctg
aaggagctggaggagtcctcgtttaggaagacgtttgaggattacctgcacaacgtggtt
ttcgtccccagaaaaacctcttcaggcactggtgccgaggaccctaggccatctcggaaa
cgcaggtcccttggcgatgttgggaatgtgacggtggccgtgcccacggtggcagctttc
cccaacacttcctcgaccagcacgcccacaagtccggaggagcacaggccctttgagaag
gtggtgaacaaggagtcgctggtcatctccggcttgcgacacttcacgggctatcgcatc
gagctgcaggcttgcaaccaagacacccctgaggaacggtgcagtgtggcagcctacgtc
agcgccaggacatgcctgaaggtggggctgctgccccaggccaaggctgatgacattgtt
ggccctgtgacgcatgaaatctttgagaacaacatcgtccacttgatgtggcaggagccg
aaggagcccaatggtctgattgtgctgtatgaagtgagttatcggcgatatggcgatgag
gagctgcatctctgtgtctcccgcaagcacttcgctctggaacggggctgcaggctgcgc
gggctgtcgccggggaactacagcgtgcgagtccgggccacctccctcgcgggcaacggc
tcctggacggaacccacctatttctacgtgacggactatttagatgtcccgtcaaatatt
gcaaaaattatcatcggccccctcatctttgtctttctcttcagtattgtgattggaagt
atttatctattcctgagaaagaggcagccagatgggccgctgggaccgctttacgcttct
tcaaaccctgagtatctcagtgccagtgatgtgtttccatgctctgtgtacgtgccggac
gagtgggaggtgcctcgagagaagatcaccctccttcgagagctggggcagggctccttc
ggcatggtgtatgagggcaacgccagggacatcatcaagggtgaggcagagacccgcgtg
gcagtgaagacggtcaacgagtcagccagtctccgagagcggattgagttcctcaatgag
gcctcggtcatgaagggcttcacctgccatcatgtggtgcgcctcctgggagtggtgtcc
aagggccagcccacgctggtggtgatggaactgatggctcacggagacctgaagagctac
ctccgttctctgcggccagaggctgagaataatcctggccgccttccccctaccctgcaa
gagatgattcagatggcggcggagattgctgacgggatggcctacctgaatgccaagaag
ttcgtgcatcgggacctggcagcgagaaactgcatggtcgcccatgattttactgtcaaa
atcggagactttggaatgaccagagacatatatgaaacggattactaccggaaaggaggc
aagggtctgctccctgtacggtggatggcaccggagtccctgaaggatggggtctttacc
acttcttctgacatgtggtcctttggcgtggtcctttgggaaatcaccagcttggcagaa
cagccttaccaaggcctgtctaatgaacaggtgttgaaatttgtcatggacggagggtat
ctggatcaacccgacaactgtccagagagagtcactgacctcatgcgcatgtgctggcaa
ttcaaccccaagatgaggccaaccttcctggagatcgtcaacctgctcaaggacgacctg
caccccagctttccggaggtgtcgttctttcacagcgaggagaacaaggctcccgagaat
gaggagctggagatggagtttgaggacatggagaacgtgcccctggaccgttcctcgcac
tgtcagagggaggaggcggggggccgggatggagggtcctcgctgggtttcaagcggagc
tacgaggaacacatcccttatacccacatgaacggaggcaagaaaaacgggcggattctg
accttgcctcggtccaatccttcctaa

KEGG   Macaca mulatta (rhesus monkey): 707455
Entry
707455            CDS       T01028                                 

Gene name
TEK
Definition
(RefSeq) angiopoietin-1 receptor isoform X1
  KO
K05121  endothelial-specific receptor tyrosine kinase [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    707455 (TEK)
   04014 Ras signaling pathway
    707455 (TEK)
   04015 Rap1 signaling pathway
    707455 (TEK)
   04066 HIF-1 signaling pathway
    707455 (TEK)
   04151 PI3K-Akt signaling pathway
    707455 (TEK)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    707455 (TEK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    707455 (TEK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    707455 (TEK)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     707455 (TEK)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  TIE family
   707455 (TEK)
CD molecules [BR:mcc04090]
 Proteins
  707455 (TEK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_Tie2_1 Pkinase fn3 Pur_ac_phosph_N APH EGF_2 fn3_2 hEGF DUF2369 Pkinase_fungal DUF4702
Other DBs
NCBI-GeneID: 707455
NCBI-ProteinID: XP_001105270
Ensembl: ENSMMUG00000006080
UniProt: G7NFP9
LinkDB
Position
15
AA seq 1124 aa
MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWHPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQ
QASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNRLCTVCVNNGVCHEDTGEC
ICPPGFMGRTCEKACEQHTFGRTCKERCSGQDGCKSYVFCLPDPYGCSCATGWKGLQCNE
ACHHGFYGPDCKLRCSCSNGETCDRFQGCLCSPGRQGLQCEREGIPRMTPKIVDLPDHIE
VNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSG
VWVCSANTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKK
LLYKPVNHYEAWRHIQVTNEIVTLNHLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTAS
IGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWT
ILDGYSISSITIRYKVQGKNEDQHIDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGS
SNPAFSHELVTLPESEAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRR
MAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLK
ARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQF
IHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSD
VWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVFDLMRQCWREKPY
ERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
NT seq 3375 nt   +upstreamnt  +downstreamnt
atggactctttagccagcttagttctctgtggagtcagcttgctcctttctggaactgtg
gaaggtgccatggacttgatcttgatcaattccctacctcttgtatctgatgccgaaaca
tctctcacctgcattgcctctgggtggcacccccatgagcccatcaccataggaagggac
tttgaagccttaatgaaccagcaccaggatccactggaagttactcaagatgtgaccaga
gaatgggctaaaaaagttgtttggaagagagaaaaggctagtaagatcaatggtgcttac
ttctgtgaagggcgagttcgaggagaggcgataaggatacgaaccatgaagatgcgtcaa
caagcttccttcctaccagctactttaactatgactgtggacaagggagataatgtgaac
atatctttcaaaaaggtattgattaaagaagaagatgcagtgatttacaaaaatggttcc
ttcatccattcagtgcctcggcatgaagtacctgatattctagaagtacacctgcctcat
gctcagccccaggatgctggagtgtactcggccaggtatataggaggaaacctcttcacc
tcggccttcaccaggctgatagtccggaggtgtgaagctcagaagtggggacctgaatgt
aaccgtctctgtactgtttgtgtcaacaatggtgtctgccatgaagatactggggaatgc
atttgccctcctgggtttatgggaaggacatgtgagaaggcttgtgaacagcacacattt
ggcagaacttgtaaagaaaggtgcagtggacaagatggatgcaagtcttacgtgttctgt
ctccctgacccctatgggtgttcctgtgccacaggctggaagggtctgcagtgcaatgaa
gcatgccaccatggtttttatgggccagattgtaagcttaggtgcagctgcagcaatggg
gagacgtgtgatcgcttccaaggatgtctctgctctccaggacggcagggactccagtgt
gagagagaaggcataccaaggatgaccccaaagatagtggatttgccagatcatatagaa
gtaaacagtggtaaatttaatcccatttgcaaagcttctggctggccgctacctactaat
gaagaaatgaccctggtgaagccggatgggacagtgctccatccaaaagactttaaccat
acggatcatttctcagtagccatattcaccatccaccggatcctcccccctgactcagga
gtttgggtctgcagtgcgaacacagtggctgggatggtggaaaagcccttcaacatttct
gttaaagttcttccaaagcccctgaatgccccaaacgtgattgacactggacataacttt
gctgtcatcaacatcagctctgagccttactttggggatggaccaatcaaatccaagaag
cttctatacaaaccagttaatcactatgaggcttggcgacatattcaagtgacaaatgag
attgttacactcaaccatttggaacctcgaacagaatatgaactctgcgtgcaactggtc
cgtcgtggagagggtggggaagggcatcctggacctgtgagacgcttcacaacagcttct
atcggactccctcctccaagaggtctaaatctcctgcctaaaagtcagaccactctaaat
ttgacctggcaaccaatatttccaagctcggaagatgacttttatgttgaagtggagaga
aggtctgtgcaaaaaagtgatcagcagaatattaaagttccaggcaacttgacttcagtg
ctacttaacaacttacatcccagggagcagtacgtggtccgagctagagttaacaccaag
gcccagggggaatggagtgaagatctcactgcttggacccttagtgacattcttcctcct
caaccagaaaacatcaagatttccaacatcacacactcctcggctgtgatttcttggaca
atattggatggctattctatttcttctattactatccgttacaaggttcaaggcaagaat
gaagatcagcacattgatgtgaagataaagaatgccaccatcactcagtatcagctcaag
ggcctagagcctgaaacagcttaccaggtggacatttttgcagagaacaacatagggtca
agcaacccagccttttctcatgaactagtgaccctcccagaatctgaagcaccagcggac
ctcggaggggggaagatgctgcttatagccatccttggctctgctggaatgacctgcctg
actgtgctgttggcctttctgatcatattgcaattgaagagggcaaatgtacaaaggaga
atggcccaagccttccaaaacgtgagggaagaaccagctgtgcagttcaactcaggaact
ctggccctaaacaggaaggtcaaaaacaacccagatcctacaatttacccagtgcttgac
tggaatgacatcaaatttcaagatgtgatcggggagggcaattttggccaagttcttaag
gcgcgcatcaagaaggatgggttacggatggatgctgccatcaagagaatgaaagaatat
gcctccaaagatgatcacagggactttgcaggagaactggaagttctttgtaaacttgga
caccatccaaacatcatcaatctcttaggagcatgtgaacatcgaggctacttgtaccta
gccattgagtatgcgccccatggaaaccttctggacttcctgcgcaagagccgtgtgctg
gagacggacccagcattcgctattgccaatagcactgcgtccacactgtcctcccagcag
ctcctccacttcgctgccgacgtggcccggggcatggactacctgagccaaaaacagttt
atccacagggatctggctgccagaaacattttagttggtgaaaactatgtggcaaaaata
gcagattttggattgtcccgaggtcaagaggtgtatgtgaaaaagacaatgggaaggctc
ccagtgcgctggatggccatcgagtcactgaattacagtgtgtacacaacgaacagtgat
gtatggtcctacggtgtgttactatgggagattgtcagcttaggaggcacaccctactgc
gggatgacttgtgcagaactctatgagaagctaccccagggctacagactggagaaaccc
ctgaactgtgatgatgaggtgtttgatctaatgagacaatgctggcgggagaagccttac
gagaggccgtcatttgcccagatattggtgtccttaaacagaatgttagaggaacgaaag
acctacgtgaataccacgctttatgagaagtttacttatgcaggaattgactgttctgct
gaagaagcggcctag

KEGG   Macaca mulatta (rhesus monkey): 708227
Entry
708227            CDS       T01028                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor precursor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04114  Oocyte meiosis
mcc04140  Autophagy - animal
mcc04144  Endocytosis
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04730  Long-term depression
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05205  Proteoglycans in cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    708227 (IGF1R)
   04014 Ras signaling pathway
    708227 (IGF1R)
   04015 Rap1 signaling pathway
    708227 (IGF1R)
   04066 HIF-1 signaling pathway
    708227 (IGF1R)
   04068 FoxO signaling pathway
    708227 (IGF1R)
   04151 PI3K-Akt signaling pathway
    708227 (IGF1R)
   04152 AMPK signaling pathway
    708227 (IGF1R)
   04150 mTOR signaling pathway
    708227 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    708227 (IGF1R)
   04140 Autophagy - animal
    708227 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    708227 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    708227 (IGF1R)
   04520 Adherens junction
    708227 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    708227 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    708227 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    708227 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    708227 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    708227 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    708227 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    708227 (IGF1R)
   05202 Transcriptional misregulation in cancer
    708227 (IGF1R)
   05205 Proteoglycans in cancer
    708227 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    708227 (IGF1R)
   05214 Glioma
    708227 (IGF1R)
   05218 Melanoma
    708227 (IGF1R)
   05215 Prostate cancer
    708227 (IGF1R)
   05224 Breast cancer
    708227 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    708227 (IGF1R)
   01522 Endocrine resistance
    708227 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    708227 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    708227 (IGF1R)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     708227 (IGF1R)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   708227 (IGF1R)
CD molecules [BR:mcc04090]
 Proteins
  708227 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 708227
NCBI-ProteinID: NP_001248281
Ensembl: ENSMMUG00000012305
UniProt: I2CWY3 G7MWA6
LinkDB
Position
7
AA seq 1367 aa
MKSGSGEGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSACGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTVADTYNITDLEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKDEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4104 nt   +upstreamnt  +downstreamnt
atgaagtctggctctggagaagggtccccgacctcgctgtgggggctcctgtttctctcc
gccgcgctctcgctctggccgacgagtggagaaatctgtgggccgggcatcgacatccgc
aacgactatcagcagctgaagcgcctggagaactgcacggtgatcgagggctacctccac
atcctgctcatctccaaggccgaggactaccgcagctaccgcttccccaagctcacggtc
atcaccgagtacttgctgttgttccgagtggctggcctagagagcctcggagacctgttc
cccaacctcacggtaatccgcggctggaaactcttctacaactacgccctggtcatcttt
gagatgaccaatctcaaggatattgggctttacaacctgaggaacattactcggggggcc
atcaggattgagaaaaatgctgacctctgttacctctccactgtggactggtccctgatc
ctggatgcagtgtccaataactacattgtggggaataagcccccaaaggaatgcggggac
ctgtgtccggggaccatggaggagaagccgatgtgcgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaaccgctgccagaaaatgtgcccgagtgcctgtggg
aagagggcatgcaccgagaacaacgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcctgacaacgacacggcctgtgtagcttgccgccactactactacgccggtgtctgc
gtgcctgcctgcccgcccaacacctacaggtttgagggctggcgctgtgtggaccgtgac
ttctgcgccaacatcctcagtgccgagagcagcgactccgagggtttcgtgatccacgac
ggcgagtgcatgcaggagtgcccctcaggcttcatccgcaacggcagccagagcatgtac
tgcatcccttgtgaaggtccttgccccaaggtctgtgaggaagaaaagaaaacaaagacc
attgattctgttacttctgctcagatgcttcaaggatgcaccatcttcaagggcaatttg
ctcattaacatccgacgggggaataacattgcttcagaactggagaacttcatggggctc
atcgaggtggtgacgggctacgtgaagatccgccattcccatgccttggtctccttgtcc
ttcctaaaaaaccttcgcctcatcttaggagaggagcagctagaagggaattactccttc
tacgtcctcgacaaccagaacttgcagcaactatgggactgggaccaccgcaacctgacc
atcaaagcagggaaaatgtactttgctttcaatcccaaattgtgtgtttcggaaatttac
cgcatggaggaagtgacggggactaaagggcgccaaagcaaaggggacataaacaccagg
aacaacggggaaagagcctcctgtgaaagtgacgtcctgcatttcacctccaccaccacg
tggaagaatcgcatcatcataacctggcaccggtaccggccccctgactacagggatctc
atcagcttcaccgtttactacaaggaagcaccttttaagaatgtcacggagtatgatggg
caggatgcctgcggctccaacagctggaacatggtggacgtggacctcccgcccaacaag
gacgtggagcccggcatcttactgcatgggctgaagccctggactcagtacgccgtttac
gtcaaggctgtgaccctcaccatggtggagaacgaccatatccgtggggccaagagtgag
atcttgtacattcgcaccaatgcttcagttccttccattcccttggacgttctttcagca
tcgaactcctcttctcagttaatcgtgaagtggaaccctccctctctgcccaacggcaac
ctgagttactacattgtgcgctggcagcggcagcctcaggacggctacctttaccggcac
aattactgctccaaagacaaaatccccatcaggaagtatgccgacggcaccattgacatt
gaggaggtcacagagaacccgaagactgaggtgtgtggtggagagaaagggccttgctgc
gcctgccccaaaactgaagctgagaagcaggccgagaaggaggaggctgagtaccgcaaa
gtctttgagaatttcctgcacaactccatctttgtgcccagacctgaaaggaagcggaga
gatgtcatgcaagtggccaacaccaccatgtccagccgaagcaggaacaccacggtggca
gacacctacaacatcacagatctggaagagctagagacagagtaccctttctttgagagc
agagtggataataaggagagaactgtcatttctaaccttcggcctttcacattgtaccgc
attgatatccacagctgcaaccacgaggctgagaaactgggctgcagcgcctccaacttt
gtctttgcaaggactatgcctgcagaaggagcagatgacattcctgggccagtgacctgg
gagccaaggcctgaaaactccatctttttaaagtggccagaacctgagaatcccaatgga
ttgattctaatgtatgaaataaaatacggatcacaagttgaggatcagcgagaatgtgtg
tccagacaggaatacaggaagtatggaggggccaagctaaaccggctaaacccggggaac
tacacagcccggattcaggctacatctctctctgggaatgggtcgtggacagatcctgtg
ttcttctatgtccaggccaaaacaggatacgaaaacttcatccatctgatcatcgctctg
cccgtcgctgtcctgttgatcgtgggagggttggtgatcatgctgtacgtcttccataga
aagagaaataacagcaggctggggaatggagtgctgtacgcgtctgtgaacccggagtac
ttcagcgctgcggatgtgtacgttcctgatgagtgggaggtggctcgggagaagatcacc
atgagccgggaacttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggt
gtggtgaaagacgaacctgaaaccagagtggccattaaaacagtgaacgaggccgcgagc
atgcgtgaaaggatcgagtttctcaacgaggcttctgtgatgaaggagttcaattgtcac
catgtggtgcggttgctgggtgtggtgtcccagggccagccaacgctggtcatcatggaa
ctgatgacgcggggcgatctcaaaagttatctccggtctctgaggccagaaatggagaat
aatccagtcctagcacctccaagcctaagcaagatgattcagatggctggagagattgca
gacggcatggcatacctcaacgccaacaagttcgtccacagagaccttgctgcccggaat
tgcatggtagccgaggatttcacagtcaaaattggagattttgggatgacgcgagatatc
tatgagacagactattaccggaaaggagggaaagggctgttgcccgtgcgctggatgtct
cccgagtccctcaaggatggagtcttcaccacttactcggacgtctggtccttcggggtt
gtcctctgggagatcgccacactggccgagcagccctaccagggcttgtccaacgagcaa
gtccttcgcttcgtcatggagggcggccttctggacaagccagacaactgccccgacatg
ctgtttgaattgatgcgcatgtgctggcagtacaaccccaagatgaggccttccttcctg
gagatcatcagcagcatcaaagacgagatggagcctggcttccgggaggtctccttctac
tacagtgaggagaacaagctgcccgagccggaggagctggacctggagccagagaacatg
gagagcgtccccctggacccctcggcctcctcgtcctccctgccactgcccgacagacac
tcaggacacaaggccgagaacggccccggccctggagtgctggtgctccgcgccagcttc
gatgagagacagccttacgcacacatgaacggtggccgcaagaacgagcgggccttgccg
ctgccccagtcttcgacctgctga

KEGG   Macaca mulatta (rhesus monkey): 709757
Entry
709757            CDS       T01028                                 

Gene name
NTRK2
Definition
(RefSeq) BDNF/NT-3 growth factors receptor precursor
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04020  Calcium signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    709757 (NTRK2)
   04014 Ras signaling pathway
    709757 (NTRK2)
   04020 Calcium signaling pathway
    709757 (NTRK2)
   04151 PI3K-Akt signaling pathway
    709757 (NTRK2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    709757 (NTRK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    709757 (NTRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    709757 (NTRK2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     709757 (NTRK2)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   709757 (NTRK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 TPKR_C2 Ig_2 ig LRR_8 LRRNT V-set LRR_5 Ig_C17orf99
Other DBs
NCBI-GeneID: 709757
NCBI-ProteinID: NP_001248226
Ensembl: ENSMMUG00000023117
UniProt: F7DGW1 G7NGF6
LinkDB
Position
15
AA seq 838 aa
MSSWIRWHGPAMARLWGFCWLVVGFWRAALACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGKVKSRQG
VGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQL
KPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKD
FHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNP
PTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYST
DYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIE
CITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
NT seq 2517 nt   +upstreamnt  +downstreamnt
atgtcgtcctggataaggtggcatggacccgccatggcgcggctctggggcttctgctgg
ctggttgtgggtttctggagggccgctctcgcttgtcccacgtcctgcaaatgcagtgcc
tctcggatctggtgcagcgacccttctcctggcatcgtggcatttccaaggttggaacct
aacagtgtagatcctgagaacatcaccgaaattttcatcgcaaatcagaaaaggttagaa
atcatcaacgaagatgatgttgaagcttacgtgggactgagaaatctgacaattgtggat
tctggattaaaatttgtggctcataaagcatttctgaaaaacagcaacctgcagcacatc
aattttacccgaaacaagttgacgagtttgtctaggaaacatttccgtcaccttgacttg
tctgaactgatcctggtaggcaatccatttacatgctcctgtgacattatgtggatcaag
actctccaagaggctaaatccagtccagacactcaggatttgtactgcctgaatgaaagc
agcaagaatattcccctggcaaacctgcagatacccaattgtggtttaccatctgcaaat
ttggccgcacctaacctcactgtggaggaaggaaagtctatcacgttatcctgtagtgtg
gcaggcgatccggttcctaatatgtattgggatgttggtaatctggtttccaaacatatg
aatgaaacaagccacacacagggctccttaaggataactaacatttcatctgatgacagt
gggaagcaaatctcttgtgtggcagaaaatcttgtaggagaagatcaagattctgtcaac
ctcactgtgcattttgcaccaactatcacatttctcgaatctccaacctcagaccaccac
tggtgcattccattcactgtgaaaggcaaccccaaaccagcgcttcagtggttctataac
ggggcaatattgaatgagtccaaatacatctgtactaaaatacatgttaccaatcacacg
gagtaccacggctgcctccagttggataatcccactcacatgaacaatggggactacact
ctaatagccaagaatgagtatgggaaggatgagaaacagatttctgctcacttcatgggc
tggcctggaattgacgatggtgcaaacccaaattatcctgatgtaatttatgaagattat
ggaactgcagcgaatgacatcggggacaccacaaacagaagtaatgaaatcccttccaca
gacgtcactgataaaaccggtcgggaacatctctcggtctatgctgtggtggtgattgcg
tctgtggtgggattttgccttttggtaatgctgtttctgcttaagttggcaagacactcc
aagtttggcatgaaagatttctcatggtttggatttgggaaagtaaaatcaagacaaggt
gttggcccagcttccgttatcagcaatgatgatgactctgccagcccactccatcacatc
tccaatgggagtaacaccccatcttcttcagaaggtggcccagatgctgtcattattgga
atgaccaagatccctgtcattgaaaatccccagtactttggcattaccaacagtcagctc
aagccagacacatttgttcagcacatcaagcgacataacattgttctgaaaagggagcta
ggcgaaggagcctttggaaaagtgttcctagctgaatgctataacctctgtcctgagcag
gacaagatcttggtggcagtgaagaccctgaaggatgccagtgacaatgcgcgcaaggac
ttccaccgcgaggccgagctcctgaccaacctccagcatgagcacatcgtcaagttctat
ggcgtctgcgtggagggtgaccccctcatcatggtcttcgagtacatgaagcacggggac
ctcaacaagttcctcagggcacacggccctgatgccgtgctgatggctgagggcaacccg
cccacggagctgacgcagtcacagatgctgcatatagcccagcagatcgccgcgggcatg
gtctacctggcgtcccagcacttcgtgcaccgcgacctggccaccaggaactgcctggtc
ggcgagaatttgctggtgaaaatcggggacttcgggatgtcccgggacgtgtacagcact
gactactatagggtcggtggccacacgatgctgcccattcgttggatgcctccagagagc
atcatgtacaggaaattcacgacagaaagtgacgtctggagcctgggggtcgtgttgtgg
gagatcttcacctacggcaaacagccctggtaccagctgtcaaacaacgaggtgatagag
tgtatcactcagggccgagtcctgcagcgaccccgcacgtgcccccaggaggtgtatgag
ctgatgctggggtgctggcagcgagagccccacatgaggaagaacatcaagggcatccat
accctccttcagaacttggccaaggcatctccggtctacctggacattctaggctag

KEGG   Macaca mulatta (rhesus monkey): 711353
Entry
711353            CDS       T01028                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    711353 (PDGFRB)
   04014 Ras signaling pathway
    711353 (PDGFRB)
   04015 Rap1 signaling pathway
    711353 (PDGFRB)
   04630 JAK-STAT signaling pathway
    711353 (PDGFRB)
   04020 Calcium signaling pathway
    711353 (PDGFRB)
   04072 Phospholipase D signaling pathway
    711353 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    711353 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    711353 (PDGFRB)
   04540 Gap junction
    711353 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    711353 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    711353 (PDGFRB)
   05206 MicroRNAs in cancer
    711353 (PDGFRB)
   05230 Central carbon metabolism in cancer
    711353 (PDGFRB)
   05231 Choline metabolism in cancer
    711353 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    711353 (PDGFRB)
   05218 Melanoma
    711353 (PDGFRB)
   05215 Prostate cancer
    711353 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    711353 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    711353 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    711353 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    711353 (PDGFRB)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     711353 (PDGFRB)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   711353 (PDGFRB)
CD molecules [BR:mcc04090]
 Proteins
  711353 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set C1-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 711353
NCBI-ProteinID: XP_001107595
Ensembl: ENSMMUG00000011557
UniProt: F7BTH1
LinkDB
Position
6
AA seq 1106 aa
MRLPGAMPALALKGQLLLLPLLLLLEPQVSQGLVITPPGPELILNVSSTFVLTCSGSAPV
VWERMSQELPQEMAKAQDNTFSSVLTLTNLTGLDTGEYFCTYNDSRGLEPDERKRLYIFV
PDPTMGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDIALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWMYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGALQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPMLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDMQEVIVVPHSLPFKAVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDSSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPEPQLERQV
EPEPELEQLPDSGCPAPRAEAEDSFL
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgcggcttccgggtgcgatgccagctctggccctcaaaggccagctgctgttgctgccc
ctgctgttactgctggaaccgcaggtctctcagggcctggtcatcacacccccggggcca
gagcttatcctcaatgtctccagcacctttgttctgacctgctcgggttcagctcccgtg
gtgtgggagcggatgtcccaggagctcccacaggaaatggccaaggcccaggacaatacc
ttctccagtgtgctgacactgaccaacctcactgggctagacacgggagaatacttttgc
acctacaatgactcccgtggactggagcctgatgagcggaaacggctctacatctttgtg
ccagatcccaccatgggcttcctccctaatgacgccgaggaactattcatctttcttacg
gaaataactgagatcaccattccatgccgagtaacagacccacaactggtggtgacactg
cacgagaagaaaggggacattgcactgcctgtcccctacgatcaccagcgtggcttttct
ggtatctttgaggacagaagctacatctgcaaaaccaccattggggacagggaggtggat
tccgacgcctactatgtctacagactccaggtgtcatccatcaacgtctccgtgaatgca
gtgcagacggtggtccgccagggtgagaacattaccctcatgtgcattgtgatcgggaat
gaggtggtcaacttcgagtggatgtacccccgcaaagaaagtgggcggctggtggagccg
gtgaccgacttcctcttggatatgccttaccacatccgctccatcctgcacatccccagt
gccgagttagaagactcggggacctacacctgcaatgtgacagagagtgtgaatgaccat
caggatgaaaaggccatcaacatcactgtggttgagagtggctacgtgcggctcctggga
gaggtgggagcactacaatttgctgagctgcaccggagccggacactgcaggtagtgttc
gaggcctaccctccgcccaccgtcctgtggttcaaagacaaccgcaccttgggcgactcc
agcgcaggcgagatcgccctgtccacgcgcaacgtgtcagagaccaggtatgtgtcagag
ctgacactcgttcgggtgaaggtggcagaggctggccactacaccatgcgggccttccat
gaggacgctgaggtccagctctccttccagctacagatcaatgtccctgtccgcgtgctg
gagctaagtgagagccacccagacagcggggaacagacagtccgctgtcgtggccggggc
atgccccagccgaacatcatctggtctgcctgcagagacctcaaaaggtgtccacgcgag
ctgccgcccatgctgctggggaacagttctgaagaggagagccagctggagacgaacgtg
acatactgggaggaggagcaggagtttgaggtggtgagcacactgcgtctgcagcacgtg
gatcggccactgtcggtgcgctgcacgctgcgcaacgctgtgggccaggacatgcaggag
gtcatcgtggtgccacactctttgcccttcaaggcggtggtgatctcagccatcctggcc
ctggtggtcctcaccatcatctcccttatcatcctcatcatgctttggcagaagaagcca
cgttacgagatccgatggaaggtgattgagtctgtgagctctgatggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacgtgggagctgccgcgggaccagctt
gtgctgggacgcaccctcggctctggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggccacgatgaaagtggccgtcaagatgcttaaatccacagcc
cgcagcagtgagaagcaagccctcatgtcggagctgaagatcatgagtcaccttgggccc
cacctgaacgtggtcaacctgttgggggcctgcaccaaaggaggacccatctatatcatc
actgagtactgccgctacggagacctggtggactacctgcaccgcaacaagcacacgttc
ctgcagcaccattccgacaagcgccgcccgcccagcgcggagctctacagcaatgcgttg
cccgttgggctccccctgcccagccacgtgtccctgactggggagagcgatggtggctac
atggacatgagcaaggacgagtcggtggactacgtgcccatgctggacatgaaaggagat
gtcaaatatgccgacatcgagtcctccaactacatggccccctacgataactacgttccc
tctgcccctgagaggacctgtcgagcaactttaatcaatgagtctccggtgctaagctac
atggaccttgtgggcttcagctaccaggtggccaatggcatggagttcctggcctccaag
aactgcgtgcaccgagacctggcggccaggaacgtgctcatctgcgagggcaagctggtc
aagatctgtgactttggcctggctcgagacatcatgcgggattcgaattacatctccaaa
ggcagtacctttttgcctttgaagtggatggctccagagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtccttcgggatcctgctctgggagatcttcactttgggt
ggcaccccttacccagagctgcccatgaatgagcagttctacaatgccatcaaacggggt
taccgcatggcccagcctgcccacgcctccgacgagatctatgagatcatgcagaagtgc
tgggaagagaagtttgagattcggccccctttctcccagctggtgctgcttctcgagaga
ctgttgggcgaaggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagt
gaccacccagccatccttcggtcccaggcccgcttgcctgggttccatggcctccgatct
cccctggacagcagctccgtcctctataccgccgtgcagcccaatgagggtgacaacgac
tatatcatccccctgcctgaccccaaacccgaggttgctgacgagggcccactggagggt
tcccccagcctagccagctccaccctgaatgaagtcaacacctcctcgaccatctcctgt
gacagccctctggagccccaggaggaaccagagccagagccccagcttgagcgccaggtg
gaaccagagccagagctggaacagctgccggattcagggtgccccgcgcctcgagcggaa
gcagaggacagcttcctgtag

KEGG   Macaca mulatta (rhesus monkey): 711407
Entry
711407            CDS       T01028                                 

Gene name
ERBB3
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-3 isoform X1
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04020  Calcium signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    711407 (ERBB3)
   04012 ErbB signaling pathway
    711407 (ERBB3)
   04020 Calcium signaling pathway
    711407 (ERBB3)
   04151 PI3K-Akt signaling pathway
    711407 (ERBB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    711407 (ERBB3)
   05205 Proteoglycans in cancer
    711407 (ERBB3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    711407 (ERBB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    711407 (ERBB3)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     711407 (ERBB3)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   711407 (ERBB3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like
Other DBs
NCBI-GeneID: 711407
NCBI-ProteinID: XP_015007426
Ensembl: ENSMMUG00000020758
UniProt: G7N7B1
LinkDB
Position
11
AA seq 1342 aa
MRANGALQVLGLLFNLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWKDIVRDQDAEIVVKDNG
RSCPLCHEVCKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMYNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG
GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKIIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEED
NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGEACQESAVSGSSEWCPR
PVSLHPMPRGCLASESSEGHVTGSEAELQEKVSTCRSRSRSRSPRPRGDSAYHSQRHSLL
TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRRHSPPRPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPVMPTAGTTPDEDY
EYMNRQRGGSGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYAHLKTLRSLEATD
SAFDNPDYWHSRLFPKANAQRT
NT seq 4029 nt   +upstreamnt  +downstreamnt
atgagggcgaacggcgctctgcaggtgctgggcttgcttttcaacctggcccggggctcc
gaggtgggcaactctcaggcagtgtgtcctgggactctgaatggcctgagtgtgaccggc
gatgctgagaaccaataccagacactgtacaagctctacgagaggtgtgaggtggtgatg
gggaacctcgagattgtgctcacgggacacaatgctgacctctccttcctgcagtggatt
cgagaagtgacaggctatgtcctcgtggccatgaatgagttctctactctaccattgccc
aacctccgagtggtgcgagggacccaggtctacgatgggaagtttgccatcttcgtcatg
ttgaactataacaccaactccagccacgctctgcgccagctccgcttgactcagctcacc
gagattctgtcagggggtgtttatattgagaagaatgataagctttgtcacatggacaca
attgactggaaggacatcgtgagggaccaagacgctgagatagtggtgaaggacaatggc
agaagctgtcccctctgtcatgaggtttgcaaggggcgatgctggggtcctggaccagaa
gactgccaaacattgaccaagaccatctgtgctcctcagtgtaatggtcactgctttggg
cccaaccccaaccagtgctgccatgatgagtgtgccgggggctgctcaggccctcaggac
acagactgctttgcctgccggcacttcaatgacagtggagcctgtgtacctcgctgtcca
cagcctcttgtctacaacaagctaactttccagctggaacccaatccccacaccaagtat
cagtatggaggagtttgtgtagccagctgtccccataactttgtggtggatcaaacatcc
tgtgttagggcctgtcctcctgacaagatggaagtagataaaaatggactcaagatgtgt
gagccttgtgggggactatgtcccaaagcctgtgagggcacaggctctgggagccgcttc
cagactgtggactcgagcaacatcgatggatttgtgaactgcaccaagatcttgggcaac
ctggactttctgatcaccggcctcaatggagacccctggcacaagatccctgccctggac
ccagagaagctcaatgtcttccggacagtacgggagatcacaggttacctgaacatccag
tcctggccaccccacatgtacaacttcagtgttttttccaacttgacaaccattggaggc
agaagcctctacaaccggggcttctcattgttgatcatgaagaacttgaatgtcacatct
ctgggcttccgatccctgaaggaaattagtgctgggcgtatctatataagtgccaatagg
cagctctgctaccaccactctttgaactggaccaaggtgcttcgggggcctacagaagag
cgactagacatcaagcataatcgtccgcgtagagactgcgtggcagagggcaaagtgtgt
gacccactgtgctcctctgggggatgctggggcccaggccctggtcagtgcttgtcctgt
cgaaactacagccgaggaggtgtctgtgtgacccactgcaactttctgaatggggagcct
cgagagtttgcccatgaggctgaatgcttctcctgccacccggaatgccaacccatggag
ggcactgccacatgcaatggctcgggctctgatacttgtgctcaatgtgcccattttcga
gatgggccccactgtgtgagcagctgcccccatggagtcctaggtgccaagggccccatc
tacaagtacccagatgttcagaatgaatgtcggccctgccatgagaactgcacccagggg
tgtaaaggaccagagcttcaagactgtttaggacaaacactggtgctgattggcaaaacc
catctgacaatggctttgacagtgatagcaggattggtagtgattttcatgatgctgggc
ggcacttttctctactggcgtgggcgccggattcagaataaaagggctatgaggcgatac
ttggaacggggtgagagcatagagcctctggaccccagtgagaaggctaacaaagtcttg
gccagaatcttcaaagagacagagttaaggaagcttaaagtgcttggctcgggtgtcttt
ggaactgtgcacaaaggagtgtggatccctgagggtgaatcaatcaagattccagtctgc
attaaaatcattgaggacaagagtggacggcaaagttttcaagctgtgacagatcatatg
ctggccattggcagcctggaccatgcccacattgtgcggctgctgggactatgcccaggg
tcatctctgcagcttgtcactcagtacttgcctctgggttctctgctggatcatgtgaga
caacaccggggggcactggggccacagctgctgctcaactggggagtacaaattgccaag
ggtatgtactaccttgaagaacatggtatggtgcatagaaacctggctgcccgaaatgtg
ctactcaagtcacccagtcaggttcaggtggcagattttggtgtggctgacctgctgcct
cctgatgataagcagctgctatacagtgaggccaagactccaattaagtggatggccctc
gagagtatccactttgggaaatacacacaccagagtgatgtctggagctatggtgtgaca
gtttgggagttgatgacctttggggcagagccctatgcagggctgcgactggctgaagta
ccagacctgctagagaagggggagcggttggcacagccccagatctgcacaattgatgtc
tacatggtgatggtcaagtgttggatgattgatgagaacattcgcccaacctttaaagaa
ctagccaatgagttcaccaggatggcccgagacccaccacggtatctggtcataaagaga
gagagtgggcctggaatagcccctgggccagagccccatggtctgacaaacaagaagcta
gaggaagtagagctggagccagaactagacctagacttagacttggaagcagaggaggac
aacctggcaaccaccacactgggctctgccctcagcctaccagttggaacacttaatcgg
ccacgtgggagccagagccttttaagtccatcatctggatacatgcccatgaaccagggt
aatcttggggaggcttgccaggagtctgcagtttctgggagcagtgaatggtgcccccgt
ccagtctctctacacccaatgccacggggatgcctggcatcagagtcatcagagggccat
gtaacaggctctgaggctgagctccaggagaaagtgtcaacgtgtaggagccggagcagg
agccggagcccacggccacgcggagatagcgcctaccattcccagcgccacagtctgctt
actcctgttaccccactctccccaccagggttagaggaagaggatgtcaacggttatgtc
atgccagatacacacctcaaaggtactccctcctcccgggaaggcaccctttcttcagtg
ggtctcagttctgtcctgggtactgaagaagaagatgaagatgaggagtatgaatacatg
aaccggaggagaaggcacagtccacctcgtccccctaggccaagttcccttgaggagctg
ggttatgagtacatggatgtggggtcagacctcagtgcttctctgggcagcacacagagt
tgcccactccaccctgtaccagtcatgcccactgctggcacaactccagatgaagactat
gaatatatgaatcggcaacgaggtggaagtggtcctgggggtgattatgcagccatgggg
gcctgcccagcatctgagcaagggtatgaagagatgagagcttttcaggggcctggacat
caggccccccatgtccattacgcccacctaaaaactctacgtagcttagaggctacagac
tctgcctttgataaccctgattactggcatagcaggcttttccccaaggctaatgcccag
agaacgtaa

KEGG   Macaca mulatta (rhesus monkey): 711512
Entry
711512            CDS       T01028                                 

Gene name
CSF1R
Definition
(RefSeq) macrophage colony-stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04151  PI3K-Akt signaling pathway
mcc04380  Osteoclast differentiation
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    711512 (CSF1R)
   04014 Ras signaling pathway
    711512 (CSF1R)
   04015 Rap1 signaling pathway
    711512 (CSF1R)
   04151 PI3K-Akt signaling pathway
    711512 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    711512 (CSF1R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    711512 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    711512 (CSF1R)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    711512 (CSF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    711512 (CSF1R)
   05202 Transcriptional misregulation in cancer
    711512 (CSF1R)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    711512 (CSF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    711512 (CSF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    711512 (CSF1R)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     711512 (CSF1R)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   711512 (CSF1R)
CD molecules [BR:mcc04090]
 Proteins
  711512 (CSF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig Ig_2 I-set C2-set_2
Other DBs
NCBI-GeneID: 711512
NCBI-ProteinID: XP_001107711
Ensembl: ENSMMUG00000011556
LinkDB
Position
6
AA seq 976 aa
MGPGVLLLLLVVTAWHGQGIPVIEPSGPELVVKPGEMVTLRCVGNGSVEWDGPISPHWTL
YSDGPSSVLTTTNATFQNTRTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAKEVVVFED
QDALLPCLLTDPVLEAGVSLVRLRGRPLLRHTNYSFSPWHGFTIHRAKFIQGQDYQCSAL
MGSRKVMSISIRLKVQKVIPGPPALTLVPEELVRIRGEAAQIVCSASNIDVDFDVFLQHN
TTKLAIPQRSDFHDNRYQKVLTLSLGQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LDLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTSINGSGTLLCA
ASGYPQPNVTWLQCAGHTDRCDEAQVLQVWVDPHPEVLSQEPFQKVTVQSLLTAETLEHN
QTYECRAHNSVGSGSWAFIPISAGARTHPPDEFLFTPVVVACMSVMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGADYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELWDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSLLQEQAQEDRRERDYTNLPSSSRSGGSGSGSSSSSSEPEEESSSEHLACCEQ
GDIAQPLLQPNNYQFC
NT seq 2931 nt   +upstreamnt  +downstreamnt
atgggcccgggagttctgctgctcctgctggtggtcacagcttggcatggtcagggaatc
ccagtgatagagcccagtggccctgagttggtcgtgaagccgggagaaatggtgaccctg
cgatgtgtgggcaatggcagtgtggaatgggatggccccatatcacctcactggaccctg
tactctgatggccccagcagcgtcctcaccaccaccaacgctaccttccaaaacacaagg
acctatcgctgcactgagcctggagaccccctgggaggcagcgccgccatccacctctac
gtcaaagatcctgcccggccctggaacgtgctagcaaaggaggtggtggtgtttgaggac
caggatgcactgctgccctgcctgctcacagacccggtgctggaggcaggcgtctcgctg
gtgcgtctgcgtggtcggcccctcctgcgccacaccaactactccttctcgccctggcac
ggcttcaccatccacagggccaaattcattcagggccaggactatcaatgcagtgccctg
atgggtagcaggaaggtgatgtccatcagcatccggctgaaagtgcagaaagtcatccca
gggcccccagccttgacactggtgcctgaagagctggtgcggattcgaggggaggctgcc
cagatcgtgtgctcagccagcaacattgacgttgactttgatgtcttcctccaacacaac
accaccaagctcgcaatccctcagcgatctgactttcacgataaccgttaccaaaaagtc
ctgaccctcagcctcggtcaagtcgacttccaacatgccggcaactactcctgcgtggcc
agcaacgtgcagggcaagcactccacctccatgttcttccgggtcgtagagagtgcctac
ttggacttgagctctgagcagaacctcatccaggaggtgaccgtgggggaggggctcaac
ctcaaagtcatggtggaggcctacccaggcctgcaaggttttaactggacctacctggga
cccttttctgaccaccagcctgagcctaagcttgctaatgctaccaccaaggacacatac
aggcacaccttcaccctctctctgccccgcctgaagccctctgaggctggccgctactcc
ttcctggccagaaacccaggaggctggagggctctgacgtttgagctcacccttcgatac
cccccagaggtaagtgtcatatggacctccatcaatggctccggcacccttttgtgtgct
gcctctgggtacccccagcccaacgtgacatggctgcagtgcgctggccacactgatagg
tgcgatgaggcccaagtgctgcaggtctgggtcgacccacaccctgaggtcctgagccag
gagcccttccagaaggtgaccgtgcagagcctgctgaccgctgagaccttagagcacaac
caaacctatgagtgcagggcccacaacagcgtggggagtggctcctgggccttcataccc
atctctgcaggagcccgcacgcatcccccggatgagttcctcttcacaccggtggtggtc
gcctgcatgtccgtcatggccttgctgctgctgctgctcctgctgctattgtacaagtat
aagcagaagcccaagtaccaggtccgctggaagatcatcgagagctatgagggcaacagt
tatactttcattgaccccacgcagctgccttacaatgagaagtgggagttcccccggaac
aacctgcagtttggtaagaccctcggagctggcgcctttgggaaggtggtggaggccaca
gcctttggtctggggaaggaggatgctgtcctgaaggtggctgtgaagatgctgaagtcc
acggcccatgctgatgagaaagaggccctcatgtctgagctgaagatcatgagccacctg
ggccagcatgagaacattgtcaaccttttgggagcctgtactcatggaggccctgtactg
gtcatcacggagtactgttgctatggcgacctgctcaactttctgcgaaggaaggctgag
gccatgctgggacccagcctgagccctggccaggaccccgagggaggcgctgactataag
aacatccacctggagaagaaatatgtccgcagggacagtggcttctccagccagggtgtg
gacacctatgtggagatgagacctgtctctacttcttcaaatgactccttctctgagcaa
gacctggacaaggaggatggacggcccctggagctctgggacctgcttcacttctccagc
caagtagcccagggcatggccttcctcgcttccaagaattgcatccaccgggatgtggca
gcgcgaaacgtgctgttgaccaatgggcatgtggccaagattggggacttcgggctggct
agggacatcatgaatgactccaactacatcgtcaagggcaatgcccgcctgcctgtgaag
tggatggccccagagagcatctttgactgtgtctacacggttcagagcgacgtctggtcc
tatggcatcctcctctgggagatcttctcacttgggctgaatccctaccctggcatcctg
gtgaacagcaagttctataaactggtgaaggatggataccaaatggcccagcctgcattt
gccccaaagaatatatacagcatcatgcaggcctgctgggccttggagcccacccacaga
cccactttccagcagatctgctccctccttcaggagcaagcccaagaggacaggagagag
cgggactataccaatctgccaagcagcagcagaagcggtggtagcggtagcggcagcagc
agcagcagcagtgagccggaggaggagagctctagtgagcacctggcctgctgcgagcaa
ggggatatcgcccagcccttgctgcagcccaacaactatcagttctgctga

KEGG   Macaca mulatta (rhesus monkey): 712829
Entry
712829            CDS       T01028                                 

Gene name
FGFR3
Definition
(RefSeq) fibroblast growth factor receptor 3 isoform X10
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04810  Regulation of actin cytoskeleton
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05219  Bladder cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    712829 (FGFR3)
   04014 Ras signaling pathway
    712829 (FGFR3)
   04015 Rap1 signaling pathway
    712829 (FGFR3)
   04020 Calcium signaling pathway
    712829 (FGFR3)
   04151 PI3K-Akt signaling pathway
    712829 (FGFR3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    712829 (FGFR3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    712829 (FGFR3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    712829 (FGFR3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    712829 (FGFR3)
   05206 MicroRNAs in cancer
    712829 (FGFR3)
   05230 Central carbon metabolism in cancer
    712829 (FGFR3)
  09162 Cancer: specific types
   05219 Bladder cancer
    712829 (FGFR3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    712829 (FGFR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    712829 (FGFR3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    712829 (FGFR3)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     712829 (FGFR3)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   712829 (FGFR3)
CD molecules [BR:mcc04090]
 Proteins
  712829 (FGFR3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig FGFR3_TM V-set C2-set_2 Pkinase_fungal DUF1533
Other DBs
NCBI-GeneID: 712829
NCBI-ProteinID: XP_001101108
Ensembl: ENSMMUG00000019945
UniProt: F7FZR9
LinkDB
Position
5
AA seq 806 aa
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRVAEVSGPEPSQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGAGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQLVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE
EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSTPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE
GCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSS
SSSGDDSVFAHDLLPPAPPSSGGSRT
NT seq 2421 nt   +upstreamnt  +downstreamnt
atgggcgcccctgcctgcgccctcgcgctctgcgtggcagtggccatcgtggccggcgcc
tcctcggagtccttggggacggagcagcgcgtcgtggggcgagtggcagaagtgtccggc
ccggagcccagccagcaggagcagttggtcttcggcagcggggacgctgtggagctgagc
tgtcccccgcccgggggtggtcccatggggcccactgtctgggtcaaggatggcgcaggg
ctggtgccctcggagcgtgtcctggtggggccccagcggctgcaggtgctgaatgcctcc
cacgaggactctggggcctacagctgccggcagcggctcacacagctcgtactgtgccac
ttcagtgtgcgggtgacagatgctccatcctcgggagatgacgaagacggggaggacgag
gctgaggacacaggtgtggacacaggggccccttactggactcggcccgagcggatggac
aagaagctgctggctgtgccggccgccaacaccgtccgcttccgctgcccggctgccggc
aaccccactccctccatctcctggctgaagaatggcaaggagttccgcggcgagcaccgc
attggcggcatcaagcttcggcaccagcagtggagcctggtcatggaaagcgtggtgccc
tcggaccgcggcaactacacctgcgtggtggagaacaagtttggcagcatccggcagaca
tacacgctggacgtgctggagcgctccccgcaccggcccatcctgcaggcggggctgccg
gccaaccagacggcggtgctgggcagcgatgtggagtttcactgcaaggtgtacagtgat
gcgcagccccacatccagtggctcaagcacgtggaggtgaatggcagcaaggtgggcccc
gacggcacaccctacgtcaccgtgctcaagacggcgggcgctaataccaccgacaaggag
ctagaggttctgtccttgcacaacgtcacctttgaggacgccggggagtacacctgcctg
gcgggcaattctattgggttttcccatcactctgcgtggctcgtggtgctgccagctgag
gaggagctggtggaggctgacgaggcgggcagtgtgtacgcaggcatcctcagctacggg
gtgggcttcttcctgttcatcctggtggtggcggctgtgacgctctgccgcctgcgcagc
acccccaagaaaggcctgggctcccccaccgtgcacaagatctcccgcttcccactcaag
cgacaggtgtccctggagtccaacgcgtccatgagctccaacacaccgctggtgcgcatc
gcaaggctgtcctcaggggagggtcccacgctggccaatgtctccgagcttgagctgcct
gctgaccccaaatgggagctgtctcgggcccggctgaccctgggcaagccccttggggag
ggctgcttcggccaggtggtcatggcggaggctatcggcattgacaaggaccgggccgcc
aagcctgtcaccgtagccgtgaagatgctgaaagatgatgccactgacaaggacctgtca
gacctggtgtctgagatggagatgatgaagatgattgggaaacacaagaacattatcaac
ctgctgggcgcctgcacgcagggcgggcccctgtacgtgctggtggagtacgcggccaag
ggcaacctgagggagtttctgcgggcgcggcggcccccgggcctggactactccttcgac
acctgcaagccgcctgaggagcagctcaccttcaaggacctggtgtcctgtgcctaccag
gtggcccgaggcatggagtacctcgcctcccagaagtgcatccacagggacctggctgct
cgaaatgtgctggtgaccgaggacaacgtgatgaagatcgcagacttcgggctggcccgc
gacgtgcacaaccttgactactacaagaagacaaccaacggccggctgcccgtgaagtgg
atggcgcctgaggccctgtttgaccgagtctacacccaccagagtgacgtctggtccttt
ggggtcctgctctgggagatcttcacgctggggggctctccgtaccccggcatccctgtg
gaggagctcttcaagctgctgaaggagggtcaccggatggacaagccggccaactgcaca
cacgacctgtacatgatcatgcgggagtgctggcatgctgcgccctcccagaggcccacc
ttcaagcagctggtggaggacctggaccgtgtcctcactgtgacgtccaccgacgagtac
ctggacctgtcagcgcccttcgagcagtactcccccggcggccaggacaccccgagctcc
agctcctcaggggatgactccgtgtttgcccacgacctgctgcccccggccccacccagc
agtgggggctcgcggacgtga

KEGG   Macaca mulatta (rhesus monkey): 715949
Entry
715949            CDS       T01028                                 

Gene name
FGFR2
Definition
(RefSeq) fibroblast growth factor receptor 2 isoform X1
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04810  Regulation of actin cytoskeleton
mcc05200  Pathways in cancer
mcc05215  Prostate cancer
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    715949 (FGFR2)
   04014 Ras signaling pathway
    715949 (FGFR2)
   04015 Rap1 signaling pathway
    715949 (FGFR2)
   04020 Calcium signaling pathway
    715949 (FGFR2)
   04151 PI3K-Akt signaling pathway
    715949 (FGFR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    715949 (FGFR2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    715949 (FGFR2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    715949 (FGFR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    715949 (FGFR2)
   05230 Central carbon metabolism in cancer
    715949 (FGFR2)
  09162 Cancer: specific types
   05226 Gastric cancer
    715949 (FGFR2)
   05215 Prostate cancer
    715949 (FGFR2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    715949 (FGFR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    715949 (FGFR2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    715949 (FGFR2)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    715949 (FGFR2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     715949 (FGFR2)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   715949 (FGFR2)
CD molecules [BR:mcc04090]
 Proteins
  715949 (FGFR2)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   715949 (FGFR2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig FGFR3_TM V-set Ig_5 C2-set_2 Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 715949
NCBI-ProteinID: XP_015003813
Ensembl: ENSMMUG00000009594
UniProt: G7N1A1 A0A5S6R976
LinkDB
Position
9
AA seq 841 aa
MGLTSTWRYGRGPGIGTVTMVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTK
YQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRD
SGLYACTATRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENGNNKRAPYWTNTEK
MEKRLHAVPAANTVKFRCPAGGNPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESV
VPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVY
SDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICK
VSNYIGQANQSAWLTVLPKQQAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRM
KNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPML
AGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLK
DDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARR
PPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVM
KIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLG
GSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRI
LTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVK
T
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgggattaacgtccacatggagatatggaagaggaccggggattggtaccgtaaccatg
gtcagctggggtcgtttcatctgcctggtcgtggtcaccatggcaaccttgtccctggcc
cggccctccttcagtttagttgaggataccacattagagccagaagagccaccaaccaaa
taccaaatctctcaaccagaagtgtacgtggctgcaccaggggagtcgctagaggtgcgc
tgcctgttgaaagatgccgccgtgatcagttggactaaggatggggtgcacttggggccc
aacaataggacagtgcttattggggagtacttgcagataaagggcgccacgcctagagac
tccggcctctatgcttgtactgccactaggactgtagacagtgaaacttggtacttcatg
gtgaatgtcacagatgccatctcatccggggatgatgaggatgacaccgatggtgcggaa
gattttgtcagtgagaacggtaacaacaagagagcgccttactggaccaacacagaaaag
atggaaaagcggctccatgctgtgcctgcggccaacactgtcaagtttcgctgcccagcg
gggggcaacccaacaccaaccatgcggtggctgaaaaacgggaaggagtttaagcaggag
catcgcattggaggctacaaggtacgaaaccagcactggagcctcattatggaaagcgtg
gtcccatctgacaagggaaattatacctgtgtggtggagaatgaatacgggtccatcaat
cacacgtaccacctggatgttgtggagcgatcgcctcaccggcccatcctccaagccgga
ctgccggcaaatgcctccacagtggttggaggagacgtagagtttgtctgcaaggtttac
agtgatgcccagccccacatccagtggatcaagcacgtggaaaagaacggcagtaaatac
gggcccgacgggctgccctacctcaaggttctcaagcactcggggataaatagttccaat
gcagaagtgctggctctgttcaatgtgaccgaggcggatgctggggaatatatatgtaag
gtctccaattatatagggcaggccaaccagtctgcctggctcactgtcctgccaaaacag
caagctcctggaagagaaaaggagattacagcttccccagactacctggagatagccatt
tactgcataggggtcttcttaatcgcctgtatggtggtaacagtcatcctgtgccgaatg
aagaacacgaccaagaagccagactttagcagccagccggctgtgcacaagctgaccaag
cgcatccccctgcggagacaggtaacagtttcggctgagtccagctcctccatgaactcc
aacaccccgctggtgaggataacaacacgcctgtcttcaacggcagacacccccatgctg
gcaggggtctctgagtatgaacttccagaggacccaaaatgggaatttccaagagataag
ctgacactgggcaagcccctgggagaaggttgctttgggcaagtggtcatggcggaagca
gtgggaatcgacaaagacaagcccaaggaggcggtcaccgtggccgtgaagatgttgaaa
gatgatgccacagagaaagacctttctgatctggtgtcagagatggagatgatgaagatg
attgggaaacacaaaaatatcataaatcttcttggagcttgcacacaggatgggcctctc
tatgtcatagttgagtatgcctctaaaggcaacctccgagaatacctccgagcccggagg
ccacctggaatggagtactcctatgacattaaccgtgttcctgaggagcagatgaccttc
aaggacttggtgtcgtgcacctaccagctggccagaggcatggagtacttggcttcccaa
aaatgtattcatcgagatttagcagccagaaatgttttggtaacagaaaacaatgtgatg
aaaatagcagactttggactcgccagagatatcaacaatatagactattacaaaaagacc
accaatggtcgacttccagtcaagtggatggctccagaagccctgtttgatagagtatac
actcatcagagtgatgtctggtccttcggggtgttaatgtgggagatcttcactttaggg
ggctcgccctacccagggattcccgtggaggaactttttaagctgctgaaggaaggacac
aggatggataaaccagccaactgcaccaacgaactgtacatgatgatgagggactgttgg
catgcggtgccctcccagagaccaacgttcaagcagttggtagaagacttggatcgaatt
ctcactctcacaaccaatgaggaatacttggacctcagccaacctctcgaacagtattca
cctagttaccctgacacaagaagttcttgttcttcaggagatgattctgttttttctcca
gaccccatgccttacgaaccatgccttcctcagtatccacacataaatggcagtgttaaa
acatga

KEGG   Macaca mulatta (rhesus monkey): 716412
Entry
716412            CDS       T01028                                 

Gene name
FLT4
Definition
(RefSeq) vascular endothelial growth factor receptor 3 isoform X1
  KO
K05097  FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc05200  Pathways in cancer
mcc05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    716412 (FLT4)
   04014 Ras signaling pathway
    716412 (FLT4)
   04015 Rap1 signaling pathway
    716412 (FLT4)
   04020 Calcium signaling pathway
    716412 (FLT4)
   04151 PI3K-Akt signaling pathway
    716412 (FLT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    716412 (FLT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    716412 (FLT4)
  09162 Cancer: specific types
   05224 Breast cancer
    716412 (FLT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    716412 (FLT4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     716412 (FLT4)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   716412 (FLT4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set Ig_6 C1-set
Other DBs
NCBI-GeneID: 716412
NCBI-ProteinID: XP_014997135
Ensembl: ENSMMUG00000018693
LinkDB
Position
6
AA seq 1362 aa
MQRSAALCLRLGLCLGLLDGLASGYSMTPPTLNITEESHVVDTGDSLSISCRGQHPLEWA
WPGAQEAPATGDKDSEDTGVVRDCEGTDVRPYCKVLLLREVRANDTGSYVCYYKYIKARI
EGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSVPGLNVTLRSQSSVLWPDG
QEVVWDDRRGMRVSTPLLREALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLLPKKSL
ELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNV
SQHDLGSYVCEANNGIQRFRESTEVIVHEKPFISVEWLKGPILEATAGDELVKLPVKLAA
YPPPEFQWYKDGKALSGRHSPHALVLKEVTEASTGIYTLALWNSAAGLRRNISLELVVNV
PPHIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIHWHWRPWTPCKMFAQRSLRRRRQR
DLMPQCRDWRAVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKV
GQDERLIYFYVTTIPDGFSIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHD
AHGNPLLLDCKNVHLFATPLAASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRS
HDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKDERLLEE
KSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILV
GTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGYGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPKGPLMVIVEYCKYGNLSNFLRAKRETFSPHAEKSPEQRGRI
RAMVELARLDRRPGSSDRVLFARFPKNEGGARRASPDQDAEDLWLSPLTMEDLVCYSFQV
ARGMEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARLPLKWM
APESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLRDGTRMRAPELAT
PAIRRIMLNCWSGDPKARPAFSELVEILGDLLQGGGLQEEEEACMAPRGSQSSEEGSFSQ
VSTVALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGTQTHGSSRMKTFEEFPMT
PMTYKASVDNQTDSGMVLASEEFEQIESRHRRESGFSCKGPDQNVDVTRAHPDSQGRRRR
PDRGARGGQVFYNSEYGELSEPSEEDHCSPSARVSFFTDNSY
NT seq 4089 nt   +upstreamnt  +downstreamnt
atgcagcggagcgccgcgctgtgcctgcgactggggctctgcctggggctcctagacggc
ctggcgagtggctactccatgacccccccaaccttgaacatcacagaggagtcacacgtc
gtcgacaccggtgacagcctgtccatctcctgcaggggacagcaccccctggagtgggcc
tggccaggagcccaggaggcaccagccactggggacaaggacagcgaggacacgggggtg
gtgcgagactgcgagggcacagacgtcaggccctactgcaaggtgttgctgctgcgtgag
gtgcgcgccaacgacacaggcagctacgtctgctactacaagtacatcaaggcccgcatc
gagggcaccacggccgccagctcctacgtgttcgtgagagacttcgagcagccgttcatc
aacaagcccgacacgctcctggtcaacaggaaagatgccatgtgggtgccctgtctggtg
tccgtccccggcctcaacgtcacgctgcgctcgcaaagctcggtgctgtggccagacggg
caggaggtggtgtgggacgaccggcggggcatgcgggtgtccacgccgctgctgcgcgag
gccctgtacctgcagtgcgagaccacctggggggaccaggacttcctttccaaccccttc
ctcgtgcacatcacaggcaacgagctctatgacatccagctgttgcccaagaagtcgctg
gagctgctggtaggggagaagctggtcctgaactgcaccgtgtgggctgagttcaactcg
ggtgtcaccttcgactgggactacccggggaagcaggcagagcggggtaagtgggtgccc
gagcgacgctcccagcagacccacacagagctctccagcatcctgaccatccacaacgtc
agccagcacgacctgggctcgtacgtgtgcgaggccaacaacggcatccagcggtttcgg
gagagcaccgaggtcattgtgcatgaaaagcccttcatcagcgtcgagtggctcaaaggc
cccatcctggaggccacggcaggagacgagctggtgaagctgcccgtgaagctggcggca
taccctccgcccgagttccaatggtacaaggatggaaaggcactgtccgggcgccacagt
ccacatgccctagtgctcaaggaggtgacagaggccagcaccggcatctacaccctcgcc
ttgtggaactccgctgctggcctcagacgcaacatcagcctggagctggtggtgaatgtg
cccccccacatacacgagaaggaagcctcctcccccagcatctactcgcgccacagccgc
caggccctcacctgcacggcctatggggtgcccctgcccctcagcatccattggcactgg
cggccctggacaccctgcaagatgtttgcccagcggagtctccggcggcggcggcagcga
gacctcatgccacagtgccgcgactggagggcagtgaccacgcaggacgccgtgaacccc
atcgagagcctggacacctggaccgagtttgtggaggggaagaataagactgtgagcaag
ctggtgatccagaatgccaacgtgtccgccatgtacaagtgtgtggtctccaacaaggtg
ggccaggatgagcggctcatctacttctatgtgaccaccatccccgacggcttcagcatc
gaatccaagccatccgaggagctactagagggccagcccgtgctcctgagctgccaagcc
gacagctacaagtacgagcatctgcgctggtaccgcctcaacctgtccacgctgcacgat
gcgcacgggaacccgctgctgctcgactgcaagaacgtgcatctgttcgccacccctctg
gccgccagcctggaggaggtggcgcctggggcgcgccacgccacgctcagcctgagtatc
ccccgcgtcgcgcccgagcatgagggccactatgtgtgcgaagtgcaagaccggcgcagc
catgacaagcactgccacaagaagtacctgtcggtgcaggccctggaggcccctcggctc
acgcagaacttgaccgacctcctggtgaacgtgagcgactccctggagatgcagtgcttg
gtggccggagcgcacgcgcccagcatcgtgtggtacaaagacgagaggctgctggaggaa
aagtctggagtcgacttggcggactccaaccagaagctgagtatccagcgcgtgcgcgag
gaggatgcgggtcgctatctgtgcagcgtgtgcaacgccaagggctgcgtcaactcctcc
gccagcgtggccgtggaaggctctgaagataagggcagcatggagatcgtgatccttgtc
ggtaccggggtcatcgctgtcttcttctgggtcctcctcctcctcatcttctgtaacatg
aggaggccggcccacgcagacatcaagacgggctacctgtccatcatcatggaccccggg
gaggtgcctctggaggagcaatgcgaatacctgtcctacgacgccagccagtgggagttc
ccccgagagcggctgcacctggggagagtgctcggctacggcgccttcgggaaggtggtg
gaagcctccgctttcggcatcaacaagggcagcagctgtgacaccgtggccgtgaaaatg
ctgaaagagggcgccacagccagcgagcaccgcgcgctgatgtcggagctcaagatcctg
attcacatcgggaaccacctcaacgtggtcaacctcctgggggcgtgcaccaagcccaag
gggcccctcatggtgatcgtggagtactgcaagtacggcaacctctccaacttcctgcgc
gccaagcgggagaccttcagcccccacgcagagaagtctcccgagcagcgcggacgcatc
cgcgccatggtggagctggccaggctggatcggaggccagggagcagcgacagggtcctc
tttgctcgtttcccgaagaacgagggcggagcgaggcgggcttctccagaccaagacgct
gaggacctgtggctgagcccgctgaccatggaagatcttgtctgctacagcttccaggtg
gccagagggatggagttcctggcttcccgaaagtgcatccacagagacctggctgctcgg
aacattctgctgtcagaaagcgacgtggtgaagatctgtgactttggccttgcccgggac
atctacaaagaccctgattacgtccgcaagggcagtgcccggctgccgctgaagtggatg
gcccctgaaagcatctttgacaaggtgtacaccacgcagagtgacgtgtggtcctttggg
gtgctgctctgggagatcttctctctgggggcctccccataccctggggtgcagatcaat
gaggagttctgccagcggctgagagacggcacgaggatgagggccccggagctggccact
cctgccatacgccgtatcatgctgaactgctggtctggagaccccaaggcgagacctgcg
ttctcggagctggtggagatcctgggggacctgctccagggcgggggcctgcaagaggaa
gaggaggcctgcatggccccacgtggctctcagagctcagaagagggcagcttctcacag
gtgtccaccgtggccctacacatcgcccaggctgacgctgaggacagcccgccaagcctg
cagcgccacagcctggccgccaggtattacaactgggtgtcctttcccgggtgcctggcc
agagggactcagacccatggttcctcccggatgaagacatttgaagaattccccatgacc
ccaatgacctacaaggcctctgtggacaaccagacggacagtgggatggtgctggcctcg
gaggagtttgagcagatagagagcaggcatagacgagaaagcggcttcagctgtaaagga
cctgaccagaatgtggatgtgaccagggcgcaccctgactcccaagggaggcggcggcgg
cctgaccggggggcccgaggaggccaggtgttttacaacagcgagtatggggagctgtcc
gagccaagcgaggaggaccactgctccccgtctgcccgcgtgtctttcttcacagacaac
agctactaa

KEGG   Macaca mulatta (rhesus monkey): 719670
Entry
719670            CDS       T01028                                 

Gene name
NTRK1
Definition
(RefSeq) high affinity nerve growth factor receptor isoform X3
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04020  Calcium signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04722  Neurotrophin signaling pathway
mcc04750  Inflammatory mediator regulation of TRP channels
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05216  Thyroid cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    719670 (NTRK1)
   04014 Ras signaling pathway
    719670 (NTRK1)
   04020 Calcium signaling pathway
    719670 (NTRK1)
   04151 PI3K-Akt signaling pathway
    719670 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    719670 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    719670 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    719670 (NTRK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    719670 (NTRK1)
   05202 Transcriptional misregulation in cancer
    719670 (NTRK1)
   05230 Central carbon metabolism in cancer
    719670 (NTRK1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    719670 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    719670 (NTRK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     719670 (NTRK1)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   719670 (NTRK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TPKR_C2 LRR_8 TrkA_TMD I-set Ig_3 Ig_2 LRR_4
Other DBs
NCBI-GeneID: 719670
NCBI-ProteinID: XP_001114243
Ensembl: ENSMMUG00000012424
LinkDB
Position
1
AA seq 822 aa
MSAEAWQQQLRAHRRLPRRSKAGAAAMLRGGRRGQLGWHSWAAGPGSLLAWLMLASAGAS
PCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELR
NLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSC
ALRWLQRWEEEGLGGVHEQKLQCHGQGPLAHMPNASCGVPMLKVQVPNASVDVGDDVLLW
CQVEGRGLEQAGWILTELEQSATVMKSGALPSLGLTLANVTSDLNRKNVTCWAENDVGRA
ELSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLE
PAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVS
FSPVDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSMLLLVLNKCGRRNKFGINRPA
VLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKW
ELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEVSESARQDFQREAELLTMLQHQHIVR
FFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQV
AAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWM
PPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPP
EVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgtcggcggaggcctggcagcagcagctgagagcgcacagacggctgccccgccggagc
aaggcgggcgccgccgcgatgctgcgaggcggacggcgcgggcagctcggctggcacagc
tgggctgcggggccgggcagcctgctggcttggctgatgttggcatctgcgggcgcctca
ccctgccccgatgcctgctgcccccacggctcctcgggactgcgatgcacacgggatggg
gccctggatagcctccaccacctgcccggcgcagagaacctgactgagctctacatcgag
aaccagcagcatctgcagcatctggagctccgtgacctgaggggcctgggggagctgaga
aacctcaccatcgtgaagagtggtctccgtttcgtggcgccagatgccttccatttcact
cctcggctcagtcgcctgaatctctccttcaatgctctggagtctctctcctggaaaact
gtgcagggcctctccttacaggaactggtcctgtcggggaaccctctgcactgttcctgt
gccctgcgctggctacagcgctgggaggaggagggactgggcggagtgcatgaacagaag
ctgcagtgtcacgggcaagggcccctggcccatatgcccaatgccagctgtggtgtgccc
atgctgaaggtccaggtgcccaatgcctccgtggatgtgggggacgatgtgctgctgtgg
tgccaggtggaggggcggggcctggaacaggccggctggatcctcacggagctggagcag
tcagccacagtgatgaaatctggggctctgccgtccctggggctgaccctggccaatgtc
accagtgacctcaacaggaagaacgtgacgtgctgggcagagaatgatgtaggccgggca
gagctctctgttcaggtcaacgtctccttcccggccagcgtgcagctgcacacggcggtg
gaaatgcaccactggtgcatccccttctctgtggatgggcagccggcaccgtctctgcgc
tggctcttcaatggctccgtgctcaatgagaccagcttcatcttcaccgagttcctggag
ccggcggccaacgagactgtgcggcacgggtgtctgcgcctcaaccagcccacccacgtc
aacaacggcaactacacgctgctggctgccaaccccttcggccaggcctccgcctccatc
atggctgccttcatggacaaccctttcgagttcaaccccgaggaccccatccctgtctcc
ttctcgccagtggatactaatagcacatctggagacccggtggagaagaaggatgaaaca
ccttttggggtctcggtggctgtgggcctggccgtctttgcctgcctcttcctttctatg
ctgctccttgtgctcaacaaatgcggaaggagaaacaagtttgggatcaaccgcccggct
gtcctggctccagaggacgggttggccatgtccctgcatttcatgacattgggtggcagc
tccctgtcccccaccgagggcaaaggctctggactccaaggccacatcatcgagaacccg
caatacttcagtgatgcctgtgttcaccacatcaagcgccgggacatcgtgctcaagtgg
gagctgggggagggcgcctttgggaaggtcttccttgctgagtgccacaaccttctgcct
gagcaggacaagatgctggtggctgtcaaggcactgaaggaggtgtcggagagtgctcgg
caggacttccagcgcgaggccgagctgctcaccatgctgcagcaccagcacattgtgcgc
ttcttcggcgtctgcaccgagggccgccccctgctcatggtctttgagtatatgcggcat
ggggacctcaaccgcttcctccgatcccatgggcctgatgccaagctgctggctggtggg
gaggatgtggctccaggccccctgggtctggggcagctgctggccgtggctagccaggtc
gctgcggggatggtgtacctggcaggtcttcattttgtgcaccgggacctggccacacga
aactgtctggtgggccaaggactggtggtcaagattggtgatttcggcatgagcagggat
atctacagcaccgactattaccgtgtgggaggccgcaccatgctgcccatccgctggatg
ccacccgagagcatcctctaccgcaagttcaccaccgagagtgacgtgtggagcttcggc
gtggtgctctgggagatcttcacctacggcaaacagccctggtaccagctctccaacact
gaggcaattgactgcatcacgcagggacgtgagttggagcggccacgtgcctgcccacca
gaggtctacgccatcatgcggggctgctggcagcgggagccccagcaacgccacagcatc
aaggacgtgcacgcccggctgcaagccctggcccaggcacctccggtctacctggacgtt
ctgggctag

KEGG   Macaca mulatta (rhesus monkey): 721712
Entry
721712            CDS       T01028                                 

Gene name
FLT3
Definition
(RefSeq) LOW QUALITY PROTEIN: receptor-type tyrosine-protein kinase FLT3
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05221  Acute myeloid leukemia
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    721712 (FLT3)
   04014 Ras signaling pathway
    721712 (FLT3)
   04151 PI3K-Akt signaling pathway
    721712 (FLT3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    721712 (FLT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    721712 (FLT3)
   05202 Transcriptional misregulation in cancer
    721712 (FLT3)
   05230 Central carbon metabolism in cancer
    721712 (FLT3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    721712 (FLT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    721712 (FLT3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    721712 (FLT3)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     721712 (FLT3)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   721712 (FLT3)
CD molecules [BR:mcc04090]
 Proteins
  721712 (FLT3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 Ig_2 I-set APH ig
Other DBs
NCBI-GeneID: 721712
NCBI-ProteinID: XP_028693282
Ensembl: ENSMMUG00000016139
LinkDB
Position
17
AA seq 993 aa
MPALARGGGRLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSAGTVYEAATVEVDVSASITLQVLVDTPXNVSCLWVFKHSSLNCQPHFDV
QNRGVVSMVILKMTXTQAGEYLXFIQSEATNYTILFTVSIRNTLLFTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKERKSSSCXKEEKVLHEIFGXDIRCCARMNGQGM
ATRLFTIGLNQSPQTTLPQYSKVGNLMIRCKAVHVNXGFGLTWDXKTKHLEEGQLLEMST
IQQQNLIRILFAFXSSVAEHTGYYTCSSSSIQSSALVLLTEKGFINATNSSEDYEIDXYE
EFCFSVXFKAYPQIRCTWTFSRKSFXCEQKALDDGYSVSKFCNHKHQPGEYIYVSQCRKW
CMPISFYFTKFSAEYKRKPQVLAEASASQASCSSDGYPLPSWTWKKCSDKSPNCTEDIPE
GVWNRKANRKVFGQWVSSSTLNMSEAMKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
SISFYATIGVCLLFIVVLTMLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFRDCDYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSRDVQIHPHSDPISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIRNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPHLTSFLGCQLEDAEEAMYQNVDG
RVSERPHIYQNRRPFSREMDSGPLSPKAQVEDS
NT seq 2982 nt   +upstreamnt  +downstreamnt
atgccggcgttggcgcgcggcggcggccggctgccgctgctcgttgttttttctgcaatg
atatttgggactattacaaatcaagatctgcctgtgatcaagtgtgttttaatcaatcat
aagaacaatgattcatcagtggggaagtcatcatcatatcccatggtgtcagaatcccca
gaagacctcgggtgtgcattgagaccccagagcgcagggacagtgtatgaagccgccacg
gtggaagtggatgtatctgcttccatcacattgcaagtgctggtcgacaccccanggaac
gtttcctgtctctgggtctttaagcacagctccctgaattgtcagccacattttgatgta
caaaatagaggagttgtttccatggtcattttgaaaatgacangaacccaagctggagaa
tacctancttttattcagagtgaagctaccaattacacaatattgtttacagtgagtata
agaaataccctgcttttcacattaagaagaccttactttagaaaaatggaaaaccaggac
gccctggtctgcatatctgagagcgttccagagccgatcgtggaatgggtgctttgcgat
tcacagggggaaagttgtaaagaaagaaagtccagcagttgttaaaaggaggagaaagtg
cttcatgagatatttggancggacataaggtgctgtgccagaatgaatgggcagggaatg
gcaaccaggctgttcacaataggtctaaatcaatctcctcagaccacattgccacaatat
tctaaagtggggaaccttatgataaggtgcaaagctgttcatgtgaacnctggattcggg
ctcacctgggattagaaaacaaagcacttggaggaagggcagctacttgagatgagtact
attcaacaacagaacttgatacggattctgtttgcttttngttcatcagtggcagaacac
acgggatactacacttgttcctcttcaagcatccagtcatccgctttggttcttcttaca
gaaaagggatttataaatgctaccaattcaagtgaagattatgaaattgacncatatgaa
gagttttgtttttccgtcnagtttaaagcctacccacaaatcagatgtacatggaccttc
tctcgaaaatcatttncttgtgagcaaaaggctctcgatgacggatacagcgtatccaag
ttttgcaatcataagcaccagccaggagaatatatatatgtatcccaatgcagaaaatgg
tgtatgccaatttcattttattttaccaaattttcagctgaatataagaggaaacctcaa
gtgctcgcggaagcatcagcgagtcaggcgtcctgttcctcggatggatacccattacca
tcttggacctggaagaagtgttcagacaagtctcctaactgcacagaagacatcccagaa
ggagtctggaatagaaaggctaacagaaaagtgtttggacagtgggtgtccagcagtact
ctaaacatgagtgaagccatgaaagggttcctggtcaagtgctgtgcatacaattccctt
ggcacatcttgtgagacgatccttttaaactctccaggccccttccctttcatccaagac
agcatctcattctatgcaacaattggtgtttgtctcctcttcattgtcgttttaaccatg
ctgatttgtcacaagtacaaaaagcaatttaggtatgaaagccagctacagatggtacag
gtgaccggctcctcagataatgagtacttctacgttgatttcagagactgtgactatgat
ctcaaatgggagtttccaagagaaaatttagagtttgggaaggtgctaggatcaggggct
tttggaaaagtgatgaacgcaacagcttatggaattagcaaaacaggagtctcaatccag
gttgcagtcaaaatgctgaaagaaaaagcagacagctctgaaagagaggcactcatgtca
gaactcaagatgatgacccagctgggaagccacgagaatattgtgaacctgctgggggcg
tgcacgctgtcaggaccaatttacttgatttttgaatattgttgctatggtgatcttctc
aactatctaagaagtaaaagagaaaaatttcacaggacttggacagagattttcaaggaa
cacaatttcagtttttaccccactttccaatcacatccaaattccagcatgcctggttca
agagacgttcagatacacccgcactcggatccaatctcagggcttcatgggaattcattt
cactctgaagatgaaattgaatatgaaaaccaaaaaaggctggaagaagaggaggacttg
aatgtgcttacatttgaagatcttctttgctttgcatatcaagttgccaaaggaatggaa
tttctggaatttaagtcgtgtgttcacagagacctggccgccaggaacgtgcttgtcacc
cacgggaaagtggtgaagatatgtgactttggattggctcgagatatcatgagtgattcc
aactatgttgtcaggggcaatgcccgtctgcctgtaaaatggatggcccctgaaagccta
tttgaagggatctataccattaagagtgatgtctggtcatacggaatattactgtgggaa
atcttctcacttggtgtgaatccttaccctggcattccggttgatgctaacttctacaaa
ctgattcgaaatggatttaaaatggatcagccattttatgctacagaagaaatatacatt
ataatgcaatcctgctgggcttttgactcaaggaagcggccatccttccctcatttgact
tcatttttaggatgtcagctggaggatgcggaagaagcgatgtatcagaatgtggatggc
cgtgtttcggaacgtcctcacatctaccaaaacaggcgacctttcagcagagagatggat
tcagggccactctctccaaaggctcaggtcgaagattcatag

DBGET integrated database retrieval system