KEGG   Macaca mulatta (rhesus monkey): 114669856
Entry
114669856         CDS       T01028                                 

Definition
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03040  Spliceosome
mcc04010  MAPK signaling pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04144  Endocytosis
mcc04213  Longevity regulating pathway - multiple species
mcc04612  Antigen processing and presentation
mcc04915  Estrogen signaling pathway
mcc05020  Prion disease
mcc05134  Legionellosis
mcc05145  Toxoplasmosis
mcc05162  Measles
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114669856
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114669856
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114669856
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114669856
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    114669856
  09152 Endocrine system
   04915 Estrogen signaling pathway
    114669856
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    114669856
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    114669856
  09171 Infectious disease: bacterial
   05134 Legionellosis
    114669856
  09172 Infectious disease: viral
   05162 Measles
    114669856
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    114669856
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    114669856
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mcc03041]
    114669856
   03009 Ribosome biogenesis [BR:mcc03009]
    114669856
   03110 Chaperones and folding catalysts [BR:mcc03110]
    114669856
   04131 Membrane trafficking [BR:mcc04131]
    114669856
   03051 Proteasome [BR:mcc03051]
    114669856
   03029 Mitochondrial biogenesis [BR:mcc03029]
    114669856
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    114669856
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     114669856
Spliceosome [BR:mcc03041]
 Complex B
  Other components
   Prp19 complex
    114669856
 Complex C
   Prp19-CDC5 complex
    114669856
Ribosome biogenesis [BR:mcc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    114669856
Chaperones and folding catalysts [BR:mcc03110]
 Heat shock proteins
  HSP70 / DNAK
   114669856
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    114669856
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    114669856
Proteasome [BR:mcc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    114669856
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    114669856
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   114669856
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Hydantoinase_A Radial_spoke_3
Other DBs
NCBI-GeneID: 114669856
NCBI-ProteinID: XP_028703547
LinkDB
Position
4
AA seq 641 aa
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggccaaagccgcggcgatcggcatcgacctgggcaccacctactcctgtgtgggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggctttcacagacaccgagcggctgatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgtttgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggcctttccaggtgatcaacgacggagacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcattctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gccggggtgatcgcggggctcaacgtgctgcggatcatcaacgagcccacggcggcggcc
atcgcctacggcctggacagaacgggcaagggggagcgcaacgtgctcatctttgatctg
ggcgggggcaccttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaaa
gccacggccggggacacccacctgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaggagttcaagagaaaacacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagcggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgtttgagggcatcgacttctatacgtccatcaccagggcg
aggttcgaggagctgtgctcggacctgttccgaagcaccctggagcccgtggagaaggct
ctacgcgacgccaagctggacaaggcccagatccacgacctggtcctggtcgggggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaaccccgacgaggctgtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggacgtggctccgctgtcg
ctggggctggagacggccggaggcgtgatgactgccctgatcaagcgcaactccaccatc
cccaccaagcagacacagatcttcaccacctactcggacaaccaacccggggtgctgatc
caggtgtacgagggcgagagggccatgacgaaggacaacaatctgttggggcgcttcgag
ctgagcggtatccctccggcccccaggggcgtgccccagatcgaggtgaccttcgacatc
gatgccaacggcatcctgaacgtcacggccacggacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggcagagaagtacaaagcggaggacgaggtgcagcgcgagagggtgtcagccaagaac
gccctggagtcgtacgccttcaacatgaagagcgccgtggaggatgaggggctcaagggc
aagatcagcgaggccgacaagaagaaggtgctggacaagtgtcaagaggtcatctcgtgg
ctggatgccaacactctggccgagaaggacgagtttgagcacaagaggaaggagctggag
caggtgtgtaaccccatcatcagcggactgtaccagggtgcgggtggtcctgggcctggc
ggcttcggggctcagggtcccaagggggggtctgggtcaggccccaccattgaggaggtg
gattag

KEGG   Macaca mulatta (rhesus monkey): 574271
Entry
574271            CDS       T01028                                 

Gene name
HSPA2
Definition
(RefSeq) heat shock-related 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03040  Spliceosome
mcc04010  MAPK signaling pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04144  Endocytosis
mcc04213  Longevity regulating pathway - multiple species
mcc04612  Antigen processing and presentation
mcc04915  Estrogen signaling pathway
mcc05020  Prion disease
mcc05134  Legionellosis
mcc05145  Toxoplasmosis
mcc05162  Measles
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    574271 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    574271 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    574271 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    574271 (HSPA2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    574271 (HSPA2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    574271 (HSPA2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    574271 (HSPA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    574271 (HSPA2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    574271 (HSPA2)
  09172 Infectious disease: viral
   05162 Measles
    574271 (HSPA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    574271 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    574271 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mcc03041]
    574271 (HSPA2)
   03009 Ribosome biogenesis [BR:mcc03009]
    574271 (HSPA2)
   03110 Chaperones and folding catalysts [BR:mcc03110]
    574271 (HSPA2)
   04131 Membrane trafficking [BR:mcc04131]
    574271 (HSPA2)
   03051 Proteasome [BR:mcc03051]
    574271 (HSPA2)
   03029 Mitochondrial biogenesis [BR:mcc03029]
    574271 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    574271 (HSPA2)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     574271 (HSPA2)
Spliceosome [BR:mcc03041]
 Complex B
  Other components
   Prp19 complex
    574271 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    574271 (HSPA2)
Ribosome biogenesis [BR:mcc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    574271 (HSPA2)
Chaperones and folding catalysts [BR:mcc03110]
 Heat shock proteins
  HSP70 / DNAK
   574271 (HSPA2)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    574271 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    574271 (HSPA2)
Proteasome [BR:mcc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    574271 (HSPA2)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    574271 (HSPA2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   574271 (HSPA2)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A DUF1464 DDR CRIC_ras_sig
Other DBs
NCBI-GeneID: 574271
NCBI-ProteinID: XP_028707443
LinkDB
Position
7
AA seq 639 aa
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI
SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEEVD
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgtctgcccgtggcccggctatcggcatcgacctgggcaccacctactcgtgcgtgggg
gtcttccaacatggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccct
agctacgtggccttcacggacaccgagcgcctcatcggcgacgccgccaagaaccaggtg
gccatgaaccccaccaacaccatcttcgacgccaagaggcttattggacggaagttcgag
gatgccacagtgcagtcggacatgaaacactggccattccgggtggtgagtgagggaggc
aagcccaaagtgcaagtggagtacaagggggagaccaagaccttcttcccggaggagata
tcctccatggtcctcacgaagatgaaggagatcgcagaagcctacctggggggcaaggtg
cacagcgccgtcataacggtccccgcctatttcaacgactcccagcgccaggccaccaag
gacgctggcaccatcacggggctcaatgtgctgcgcatcatcaacgagcccacagcggcg
gccatcgcctacggcctggacaagaagggctgtgcgggcggcgagaagaacgtgctcatc
tttgacctgggcggtggcaccttcgacgtgtccatcctgaccatcgaggacggcatcttc
gaggtgaagtccacggccggcgacactcacctgggcggtgaggacttcgacaaccgcatg
gtgagccacctggcggaggagttcaagcgcaagcacaagaaggacattgggcctaacaag
cgcgccgtgaggcggctgcgcaccgcctgcgagcgcgccaagcgcaccctgagctcgtcc
acgcaggcgagcatcgagatcgactcgctgtatgagggcgtggacttctatacgtccatc
acccgcgcccgcttcgaggagctcaatgccgacctctttcgcgggaccctggagccggtg
gagaaggcgctgcgcgacgccaagctggacaagggccagatccaggagatcgtgctggtg
ggcggctccactcgtatccccaagatccagaagctgctgcaggatttcttcaacggcaag
gagctgaacaagagcatcaaccccgacgaggcagtggcctatggcgccgcggtgcaggcg
gccatcctcatcggcgacaaatcggagaatgtgcaggacctgctgctccttgacgtgacc
ccgttgtcgctgggcatcgagacagctggcggtgtcatgaccccactcatcaagaggaac
accacgatccccaccaagcagacgcagaccttcaccacctactcggacaatcagagcagc
gtgctggtgcaggtatacgagggcgaacgggccatgaccaaggacaataacctgctgggc
aagttcgacctgaccgggattccccctgcgcctcgcggggtcccccagatcgaggtcacc
ttcgacattgacgccaatggcatccttaacgttaccgccgccgacaagagcaccggtaag
gaaaacaaaatcaccatcaccaacgacaaaggtcgtctgagcaaggacgacattgaccga
atggtgcaggaggcggagcggtacaaatcggaagatgaggcgaatcgtgaccgagtcgca
gccaaaaacgccctggagtcctatacctacaacatcaagcagacggtggaagatgagaaa
ctgaggggcaagattagcgagcaggacaaaaacaagatcctcgacaagtgtcaggaggtg
atcaactggctcgaccgaaaccagatggcagagaaagatgagtatgaacacaagcagaaa
gagctcgaaagagtttgcaaccccatcatcagcaaactttaccaaggtggtcctggcggc
ggcagcggcggcggcggttcaggagcctccgggggaccgactatcgaagaagtggactaa

KEGG   Macaca mulatta (rhesus monkey): 707989
Entry
707989            CDS       T01028                                 

Gene name
HSPA8
Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03040  Spliceosome
mcc04010  MAPK signaling pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04144  Endocytosis
mcc04213  Longevity regulating pathway - multiple species
mcc04612  Antigen processing and presentation
mcc04915  Estrogen signaling pathway
mcc05020  Prion disease
mcc05134  Legionellosis
mcc05145  Toxoplasmosis
mcc05162  Measles
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    707989 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    707989 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    707989 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    707989 (HSPA8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    707989 (HSPA8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    707989 (HSPA8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    707989 (HSPA8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    707989 (HSPA8)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    707989 (HSPA8)
  09172 Infectious disease: viral
   05162 Measles
    707989 (HSPA8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    707989 (HSPA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    707989 (HSPA8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mcc03041]
    707989 (HSPA8)
   03009 Ribosome biogenesis [BR:mcc03009]
    707989 (HSPA8)
   03110 Chaperones and folding catalysts [BR:mcc03110]
    707989 (HSPA8)
   04131 Membrane trafficking [BR:mcc04131]
    707989 (HSPA8)
   03051 Proteasome [BR:mcc03051]
    707989 (HSPA8)
   03029 Mitochondrial biogenesis [BR:mcc03029]
    707989 (HSPA8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    707989 (HSPA8)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     707989 (HSPA8)
Spliceosome [BR:mcc03041]
 Complex B
  Other components
   Prp19 complex
    707989 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    707989 (HSPA8)
Ribosome biogenesis [BR:mcc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    707989 (HSPA8)
Chaperones and folding catalysts [BR:mcc03110]
 Heat shock proteins
  HSP70 / DNAK
   707989 (HSPA8)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    707989 (HSPA8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    707989 (HSPA8)
Proteasome [BR:mcc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    707989 (HSPA8)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    707989 (HSPA8)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   707989 (HSPA8)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Other DBs
NCBI-GeneID: 707989
NCBI-ProteinID: NP_001248586
Ensembl: ENSMMUG00000004696
UniProt: F6RLH5
LinkDB
Position
14
AA seq 646 aa
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgtccaagggacctgcagttggtattgatcttggcaccacctactcttgtgtgggtgtt
ttccagcacggaaaagtagagataattgccaatgatcagggaaaccgaaccactccaagc
tatgttgcctttacggacactgaacggttgatcggtgacgctgcaaagaatcaagttgca
atgaaccccaccaacacagtttttgatgccaaacgtctgattggacgcagatttgatgat
gctgttgtccagtctgatatgaagcattggcccttcatggtggtgaatgatgctggcagg
cccaaggtccaagtagaatataagggagagaccaaaagcttctatccagaggaggtatcc
tctatggttctgacaaagatgaaggaaattgcagaagcctatcttgggaagactgttacc
aatgctgtggtcacagtgccagcttattttaatgactctcagcgtcaggctaccaaagat
gctggaactattgctggtctcaatgtacttagaattattaatgagccaactgctgctgct
attgcttacggcttagacaaaaaggttggagcagaaagaaacgtgcttatctttgacctg
ggaggtggcactttcgatgtgtcaatcctcactattgaggatggaatctttgaggtcaag
tctacagctggagacacccacttgggtggagaagattttgacaaccgaatggtcaaccat
tttattgcagagttcaagcgcaagcataagaaggacatcagcgagaacaagagagctgta
agacgccttcgtactgcttgtgaacgtgctaagcgtacgctctcttccagcacccaggcc
agtattgagatcgattctctctatgaaggaatcgacttctatacctccattacccgtgcc
cgatttgaagaattgaatgctgacctgttccgtggcaccctggacccagtagagaaagcc
cttcgagatgccaaactagacaagtcacagattcatgatattgtcctggttggtggttct
actcgtatccccaagattcagaagcttctccaagatttcttcaacggaaaagaactgaat
aagagcatcaaccctgatgaggctgttgcttatggtgcagctgtccaggcagccatcttg
tctggagacaagtctgaaaatgttcaagatttgttgctcttggatgtcactcctctttcc
cttggtattgaaactgctggtggagtaatgaccgtccttattaagcgtaataccaccatt
cctaccaagcagacacagaccttcactacctattctgacaaccagcctggtgtgcttatt
caggtctatgaaggagagcgtgccatgaccaaggataacaacctgcttggcaagtttgaa
ctcacgggcatacctcctgcaccccgaggtgttcctcagattgaagtcacttttgacatt
gatgccaatggtatcctgaatgtctctgctgtggacaagagtacaggaaaagagaataag
attactatcactaatgacaagggccgtttgagcaaggaagacattgaacgtatggtccag
gaagctgagaagtacaaagctgaagatgagaagcagagggacaaggtatcatccaagaat
tcacttgagtcctatgcattcaacatgaaagcaactgtcgaagacgagaaacttcaaggc
aagattaacgatgaggacaaacagaagattctggacaagtgtaatgaaattatcaactgg
cttgataagaatcagactgccgagaaggaagagtttgaacatcagcagaaagagctggag
aaagtttgcaaccccatcatcaccaagctgtaccagagtgcaggaggcatgccaggagga
atgcctgggggattccctggtggtggagctcctccctctggtggtgcttcctcagggccc
actattgaagaggttgattaa

KEGG   Macaca mulatta (rhesus monkey): 709412
Entry
709412            CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03040  Spliceosome
mcc04010  MAPK signaling pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04144  Endocytosis
mcc04213  Longevity regulating pathway - multiple species
mcc04612  Antigen processing and presentation
mcc04915  Estrogen signaling pathway
mcc05020  Prion disease
mcc05134  Legionellosis
mcc05145  Toxoplasmosis
mcc05162  Measles
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    709412
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    709412
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    709412
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    709412
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    709412
  09152 Endocrine system
   04915 Estrogen signaling pathway
    709412
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    709412
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    709412
  09171 Infectious disease: bacterial
   05134 Legionellosis
    709412
  09172 Infectious disease: viral
   05162 Measles
    709412
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    709412
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    709412
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mcc03041]
    709412
   03009 Ribosome biogenesis [BR:mcc03009]
    709412
   03110 Chaperones and folding catalysts [BR:mcc03110]
    709412
   04131 Membrane trafficking [BR:mcc04131]
    709412
   03051 Proteasome [BR:mcc03051]
    709412
   03029 Mitochondrial biogenesis [BR:mcc03029]
    709412
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    709412
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     709412
Spliceosome [BR:mcc03041]
 Complex B
  Other components
   Prp19 complex
    709412
 Complex C
   Prp19-CDC5 complex
    709412
Ribosome biogenesis [BR:mcc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    709412
Chaperones and folding catalysts [BR:mcc03110]
 Heat shock proteins
  HSP70 / DNAK
   709412
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    709412
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    709412
Proteasome [BR:mcc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    709412
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    709412
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   709412
SSDB
Motif
Pfam: HSP70 MreB_Mbl HORMA
Other DBs
NCBI-GeneID: 709412
NCBI-ProteinID: XP_014988573
LinkDB
Position
3
AA seq 647 aa
MSKGPAVGIDLGTTYSCMGVFQHGKVEIIANDQGNRTTPSYVAFTDTEQLINDAAKNQVV
MNPTNTVFDAKHLIGCRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SVVLAKMKEIAEAYLGKTVTNALVTVRAYFNVSQRQTTKHAVTIVGLNVLRIINEPPTAA
AIAYGLNKKVGAERNVLIFDLVGGIFGVSVLTIEYGIFEIKSTARDTHLGGEDFDNRMVN
HFIAEFKCKHKKDISENKRAVRRLCTACECAKHTXSSSTQASVEIDCLYEGIDFYTSITH
AQFEELNADLFHGTLDPVEKALRDAKLDKSQIHDIVLVGGSTLIPKIQKLLQDFSNGKEL
NKSINPDEAVASGIAVQAAIVSGDKSENVQXLLLFDVTPLSLGIETAGGIMTVLIKRNTT
IPTKQTQTFTTYSDNQPGVLIQVYEGECAMTKDNNLLGKFELMGIPPAPRGVPQIEVIFY
IDANGILNVSAVDKNTGKENKLTVTNDKGRLSKEDTERMFQEAEKYKAEDEKQRDKVSSK
NSLESYAFNMKATVKDEKLQGKINDEDKQKILDKCNEIINXLDKNHTAEKEAFEHQQKEL
EKVCNPIITKLYQSAGGMPGGIPGGFPGSGAPPSGGASSGPTIEEVD
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgtccaagggacctgcagttggtattgatcttggcaccacctactcttgtatgggtgtt
ttccagcacggaaaagtagagataattgccaatgatcagggaaaccgaaccactccaagc
tatgttgcctttacggacactgaacagttgatcaatgatgctgcaaagaatcaagttgta
atgaaccccactaacacagtttttgatgccaaacatctgattggatgcagatttgatgat
gctgttgtccagtctgatatgaagcattggcccttcatggtggtgaatgatgctggcagg
cccaaggtccaagtagaatacaagggagagaccaaaagcttctatccagaggaggtatcc
tctgtggttctggcaaaaatgaaggaaattgcagaagcctaccttgggaagactgttacc
aatgctctggtcacagtgcgagcttactttaatgtgtctcagcgtcagactaccaaacat
gctgtaactattgttggtctcaatgtacttagaattattaatgagcctccaacggctgct
gctattgcttatggcttaaacaaaaaggttggagcagaaagaaacgtgctgatctttgac
ctggtaggtggcattttcggagtgtcagtcctcactattgagtatggaatctttgagatc
aagtccacagccagagacacacacttgggtggagaagattttgacaaccgaatggtcaac
cattttattgctgaattcaagtgcaagcataagaaggacatcagtgagaacaagagagct
gtaagacgcctctgtactgcttgtgaatgtgctaagcatactnnctcttccagcacccag
gccagtgttgagatcgattgtctctatgaaggaatcgacttctatacctccattacccat
gcccaatttgaagaattgaatgctgacctcttccacggaaccctggacccagtagagaaa
gcccttcgagatgccaaactagacaagtcacagattcatgatattgtcctagttggtggt
tctactcttatccccaagattcagaagcttctccaagacttctccaatggaaaagaactg
aataagagcatcaaccctgatgaagctgttgcatctggtatagctgtccaggcagccatt
gtgtctggagacaagtctgaaaatgttcaangtttgctgctctttgatgtcactcctctt
tcccttggtattgaaactgctggtggtatcatgaccgttctcatcaagcgtaataccacc
attcctaccaagcagacacagaccttcactacctattctgacaaccagcctggtgtgctt
attcaggtttatgaaggtgagtgtgccatgaccaaggataacaacttgcttggcaagttt
gaactcatgggcatacctcctgcaccccgaggtgttcctcagattgaagtcattttttac
attgatgccaatggtatcctcaatgtctctgctgtggacaagaatacaggaaaagagaat
aagcttactgttactaatgacaagggtcgtttgagcaaggaagatactgaacgtatgttc
caggaagctgagaagtacaaagctgaagatgagaagcagagggacaaggtgtcatccaag
aattcacttgagtcctatgcattcaacatgaaagcaactgtcaaagatgagaaacttcaa
ggcaagattaacgatgaggacaaacagaagattttggacaagtgtaatgaaattatcaac
tgactcgataagaatcacactgccgagaaggaagcatttgaacatcagcagaaagagctg
gagaaagtttgcaaccccatcatcaccaagctgtaccagagtgcaggaggcatgccagga
ggaatacctgggggattccctggtagtggagctcctccctctggtggtgcttcctcaggg
cccaccattgaagaggttgattaa

KEGG   Macaca mulatta (rhesus monkey): 716633
Entry
716633            CDS       T01028                                 

Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03040  Spliceosome
mcc04010  MAPK signaling pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04144  Endocytosis
mcc04213  Longevity regulating pathway - multiple species
mcc04612  Antigen processing and presentation
mcc04915  Estrogen signaling pathway
mcc05020  Prion disease
mcc05134  Legionellosis
mcc05145  Toxoplasmosis
mcc05162  Measles
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    716633
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    716633
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    716633
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    716633
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    716633
  09152 Endocrine system
   04915 Estrogen signaling pathway
    716633
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    716633
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    716633
  09171 Infectious disease: bacterial
   05134 Legionellosis
    716633
  09172 Infectious disease: viral
   05162 Measles
    716633
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    716633
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    716633
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mcc03041]
    716633
   03009 Ribosome biogenesis [BR:mcc03009]
    716633
   03110 Chaperones and folding catalysts [BR:mcc03110]
    716633
   04131 Membrane trafficking [BR:mcc04131]
    716633
   03051 Proteasome [BR:mcc03051]
    716633
   03029 Mitochondrial biogenesis [BR:mcc03029]
    716633
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    716633
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     716633
Spliceosome [BR:mcc03041]
 Complex B
  Other components
   Prp19 complex
    716633
 Complex C
   Prp19-CDC5 complex
    716633
Ribosome biogenesis [BR:mcc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    716633
Chaperones and folding catalysts [BR:mcc03110]
 Heat shock proteins
  HSP70 / DNAK
   716633
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    716633
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    716633
Proteasome [BR:mcc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    716633
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    716633
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   716633
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Other DBs
NCBI-GeneID: 716633
NCBI-ProteinID: XP_001113356
Ensembl: ENSMMUG00000029822
UniProt: F7CZ86
LinkDB
Position
4
AA seq 641 aa
MAAAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEGGKPKVLVSYKGENKAFYPEE
ISSMVLTKMKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGGRGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAA
KNALESYAFNMKSVVSDEGLKGKISESDKKKILDKCNELLSWLEANQLAEKDEFDHKRKE
LEQMCNPIITKLYQGGCTGPACGTGYAPGRPATGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggctgctgccaagggaattgccataggtatcgacctgggcaccacctactcctgtgtg
ggggtgttccagcacggcaaggtggagatcatcgccaatgaccagggcaaccgcaccacc
cccagctacgtggccttcacagacaccgagcggctcattggggatgcggccaagaaccag
gtagccatgaatccccagaacactgtttttgatgccaaacgtctgatcggcaggaaattt
aatgatcctgttgtgcaatcagatatgaaactttggccttttcaagtgattaatgaagga
ggcaagcccaaagtgcttgtgtcctacaaaggggagaataaagctttctaccctgaggaa
atctcttcgatggtactgactaagatgaaagagactgctgaggcgtttttgggccaccct
gtcaccaatgcagtgattaccgtgccagcctatttcaatgactctcaacgtcaggctact
aaggatgcaggtgtgattgctggacttaatgtgctacgaatcatcaatgagcccacagct
gctgccattgcctatggtttagataaaggaggtcgaggagaacgacatgtcctgattttt
gatctgggtggaggcacatttgatgtgtcaattctgaccatagatgatgggatttttgag
gtaaaggccactgctggggacactcacctgggtggggaggactttgacaacaggcttgtg
agccacttcgtggaagagttcaagcggaagcacaagaaggacatcagccagaacaagcga
gccgtgaggcggctgcgcacagcctgcgagagggccaagaggaccctgtcgtccagcacc
caggccaacctagaaattgattcactttatgaaggcattgacttctacacatccatcacc
agagctcgatttgaagagttgtgtgcagacctttttaggggtaccctggagcctgtagaa
aaagcacttcgggatgccaagatggataaggctaaaatccatgacattgttttagtaggg
ggctccacccgcatccccaaggtgcagcggctgcttcaggactactttaatggacgtgat
ctcaacaagagcatcaaccctgatgaggcagtagcatatggggctgcggtacaggcggcc
atcctgatgggggacaagtctgagaaggtgcaggacctgctgctgctggacgtggctccc
ctgtcgctggggctggagacggccgggggtgtgatgactgccctgatcaagcgtaactcc
accatccccaccaagcagacacagatcttcaccacctactccgacaaccaacccggggtg
ctgatccaggtatacgaaggtgagagggccatgacgaaggacaacaacctgctagggcgc
tttgacctgactggaatccctccagcacccaggggagttcctcagatcgaggtgacgttt
gacattgatgccaatggtattctcaatgtcacagccatggacaagagcacagggaaggcc
aacaagatcaccatcaccaatgacaagggccgcctgagcaaggaggagattgagcgcatg
gttctggatgctgagaaatataaagctgaagatgaggtccagagggagaaaattgctgca
aagaatgccttagaatcctatgcttttaacatgaagagtgttgtgagtgatgaaggtttg
aagggcaagatcagtgagtctgataaaaagaaaatactggataaatgcaatgaacttctt
tcgtggctggaggccaatcaactggcagagaaagatgagtttgatcataagagaaaggaa
ttggagcagatgtgtaaccccatcatcacaaaactctaccagggaggatgcactgggcct
gcctgtggaacagggtatgcgcctggaaggcctgccacaggccccacaattgaagaagta
gattaa

KEGG   Macaca mulatta (rhesus monkey): 720001
Entry
720001            CDS       T01028                                 

Gene name
HSPA6
Definition
(RefSeq) LOW QUALITY PROTEIN: heat shock 70 kDa protein 6
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03040  Spliceosome
mcc04010  MAPK signaling pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04144  Endocytosis
mcc04213  Longevity regulating pathway - multiple species
mcc04612  Antigen processing and presentation
mcc04915  Estrogen signaling pathway
mcc05020  Prion disease
mcc05134  Legionellosis
mcc05145  Toxoplasmosis
mcc05162  Measles
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    720001 (HSPA6)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    720001 (HSPA6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    720001 (HSPA6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    720001 (HSPA6)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    720001 (HSPA6)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    720001 (HSPA6)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    720001 (HSPA6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    720001 (HSPA6)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    720001 (HSPA6)
  09172 Infectious disease: viral
   05162 Measles
    720001 (HSPA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    720001 (HSPA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    720001 (HSPA6)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mcc03041]
    720001 (HSPA6)
   03009 Ribosome biogenesis [BR:mcc03009]
    720001 (HSPA6)
   03110 Chaperones and folding catalysts [BR:mcc03110]
    720001 (HSPA6)
   04131 Membrane trafficking [BR:mcc04131]
    720001 (HSPA6)
   03051 Proteasome [BR:mcc03051]
    720001 (HSPA6)
   03029 Mitochondrial biogenesis [BR:mcc03029]
    720001 (HSPA6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    720001 (HSPA6)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     720001 (HSPA6)
Spliceosome [BR:mcc03041]
 Complex B
  Other components
   Prp19 complex
    720001 (HSPA6)
 Complex C
   Prp19-CDC5 complex
    720001 (HSPA6)
Ribosome biogenesis [BR:mcc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    720001 (HSPA6)
Chaperones and folding catalysts [BR:mcc03110]
 Heat shock proteins
  HSP70 / DNAK
   720001 (HSPA6)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    720001 (HSPA6)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    720001 (HSPA6)
Proteasome [BR:mcc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    720001 (HSPA6)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    720001 (HSPA6)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   720001 (HSPA6)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Other DBs
NCBI-GeneID: 720001
NCBI-ProteinID: XP_014969437
LinkDB
Position
1
AA seq 640 aa
MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTQRLVGDAAKSQ
VALNPDNTVFDAKRLIGRKFADTTVQSDMKHWPFQVVSEGGKPKVRVSYRGEDKTFYPEE
ISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDTQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLDRRGXNVLIFDLGGGSFDVSVLSIDAGVFEVKATAGNTHLGGEDFDNRLVNYF
MEEFRRKHGKDLSGNKRALRRLRTACEPAKRTLSSSTQATLEIDSLFEGVDFYTSITRAR
FEELCSDLFRSTLEPVEKALRDANLDKAQIHDVVLVGGSTHIPKVQKLLQDFFSGKELDK
SINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRKAAIP
TMQTQTFTTXSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDID
ANGILSVTATDRSTGKDNKITITNDKGRLSKEEVERMVHEAEQCKAEDEAQRDRVSAKNS
LEAHVFLVKGFLQEESLRDKIPEEDRRNVQDKCQEVLAWLEHNQLAEKEEYEHQKRELEQ
ICRPIFSRLYGGPGVPGGSSCGAQARQGDPSTGPIIEEVD
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgcaggccccacgggagctcgcggtgggcatcgacctgggcaccacctactcgtgcgtg
ggcgtgtttcagcagggtcgcgtggagattctggccaacgaccagggcaaccgcaccacg
cccagctacgtggccttcaccgacacccagcggctggtcggggacgcggccaagagccag
gtggccctgaacccggacaacaccgtgttcgacgccaagcggctgatcggtcgcaagttc
gcggacaccacggtgcagtcggacatgaagcactggcccttccaggtggtgagcgagggc
ggcaagcccaaggtgcgcgtgtcctaccgcggggaggacaagacgttctaccccgaggag
atctcgtccatggtgctgagcaagatgaaggagacagccgaggcctatctgggccagccc
gtgaagcacgcggtgatcaccgtgcccgcctacttcaatgacacgcagcgccaggccacc
aaggacgcgggggccatcgcggggctcaacgtgctgcggatcatcaatgagcccacggcg
gccgccatcgcctatgggctggaccggcggggcngcaatgtgctcatttttgacctgggt
gggggctccttcgacgtgtcggttctctccattgacgccggtgtctttgaggtgaaagcc
actgctggaaatacccacctgggtggagaagacttcgacaaccggctggtgaactacttc
atggaagaattccggcggaagcatgggaaggacctaagtgggaacaagcgggccctgcgg
aggctgcgcacagcctgtgagccagccaagcgcaccctgtcctccagcacccaggccacc
ctggagatagactcgctgttcgagggcgtggacttctacacgtccatcactcgtgcgcgc
tttgaggaactgtgctcagacctcttccgcagtaccctggaaccggtggagaaggccctg
cgggatgccaacctggacaaggcccagattcatgacgtcgtcctggtggggggctccact
cacatccccaaggtgcagaagttgctgcaggacttcttcagcggcaaagagctcgacaag
agcatcaaccctgatgaggctgtggcttatggggctgctgtgcaggcggccgtgttgatg
ggggacaagtgtgagaaagtacaggatcttctgctgctggatgtggctcccctgtctctg
ggactggagacagcaggtggggtgatgaccacgctgatccagaggaaggccgctatcccc
accatgcagacccagactttcaccacctagtcggacaaccagcctggggtcttcatccag
gtgtatgagggtgagagggccatgaccaaggacaacaacctgctggggcgttttgaactc
agtggcatccctcctgccccacgtggagtcccccagatagaggtgacctttgacattgat
gctaatggcatcctgagcgtgacagctactgacaggagcacaggtaaggataacaagatc
accatcaccaatgacaagggccggctgagcaaggaggaggtggagaggatggttcatgaa
gccgagcagtgcaaggctgaggatgaggcccagagggacagagtgtctgccaaaaactcg
ctggaggcccatgtcttccttgtgaaaggttttttgcaagaggaaagccttagggacaag
attcccgaagaggacaggcgcaatgtgcaagacaagtgtcaggaagtccttgcctggctg
gagcacaaccagctggcagagaaggaggagtatgagcatcagaagagggagctggagcaa
atctgtcgccccatcttctccaggctctatggagggcctggtgtccctgggggcagcagt
tgtggcgctcaagcccgtcagggggaccccagcaccggccccatcattgaggaggttgat
tga

KEGG   Macaca mulatta (rhesus monkey): 720054
Entry
720054            CDS       T01028                                 

Gene name
HSPA1A
Definition
(RefSeq) heat shock 70 kDa protein 1A
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03040  Spliceosome
mcc04010  MAPK signaling pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04144  Endocytosis
mcc04213  Longevity regulating pathway - multiple species
mcc04612  Antigen processing and presentation
mcc04915  Estrogen signaling pathway
mcc05020  Prion disease
mcc05134  Legionellosis
mcc05145  Toxoplasmosis
mcc05162  Measles
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    720054 (HSPA1A)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    720054 (HSPA1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    720054 (HSPA1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    720054 (HSPA1A)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    720054 (HSPA1A)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    720054 (HSPA1A)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    720054 (HSPA1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    720054 (HSPA1A)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    720054 (HSPA1A)
  09172 Infectious disease: viral
   05162 Measles
    720054 (HSPA1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    720054 (HSPA1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    720054 (HSPA1A)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mcc03041]
    720054 (HSPA1A)
   03009 Ribosome biogenesis [BR:mcc03009]
    720054 (HSPA1A)
   03110 Chaperones and folding catalysts [BR:mcc03110]
    720054 (HSPA1A)
   04131 Membrane trafficking [BR:mcc04131]
    720054 (HSPA1A)
   03051 Proteasome [BR:mcc03051]
    720054 (HSPA1A)
   03029 Mitochondrial biogenesis [BR:mcc03029]
    720054 (HSPA1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    720054 (HSPA1A)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     720054 (HSPA1A)
Spliceosome [BR:mcc03041]
 Complex B
  Other components
   Prp19 complex
    720054 (HSPA1A)
 Complex C
   Prp19-CDC5 complex
    720054 (HSPA1A)
Ribosome biogenesis [BR:mcc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    720054 (HSPA1A)
Chaperones and folding catalysts [BR:mcc03110]
 Heat shock proteins
  HSP70 / DNAK
   720054 (HSPA1A)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    720054 (HSPA1A)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    720054 (HSPA1A)
Proteasome [BR:mcc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    720054 (HSPA1A)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    720054 (HSPA1A)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   720054 (HSPA1A)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Hydantoinase_A Radial_spoke_3
Other DBs
NCBI-GeneID: 720054
NCBI-ProteinID: XP_014991489
UniProt: G7MRK7 A0A5F8A2S3
LinkDB
Position
4
AA seq 641 aa
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggccaaagccgcggcgatcggcatcgacctgggcaccacctactcctgtgtgggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggcttttacagacaccgagcggctgatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgtttgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggcctttccaggtgatcaacgacggagacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcattctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gcgggggtgatcgcggggctcaacgtgctgcggatcatcaacgagcccacggcggcggcc
atcgcctacggcctggacagaacgggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaaa
gccacggccggggacacccacctgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaggagttcaagagaaaacacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagcggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgtttgagggcatcgacttctacacgtccatcaccagggcg
aggttcgaggagctgtgctcggacctgttccgaagcaccctggagcccgtggagaaggct
ctgcgcgacgccaagctggacaaggcccagatccacgacctggtcctggtcgggggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaaccccgatgaggctgtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggacgtggctccgctgtcg
ctggggctggagacggccggaggcgtgatgactgccctgatcaagcgcaactccaccatc
cccaccaagcagacacagatcttcaccacctactcggacaaccaacccggggtgctgatc
caggtgtacgagggcgagagggccatgacgaaggacaacaatctgttggggcgcttcgag
ctgagcggtatccctccggcccccaggggcgtgccccagatcgaggtgaccttcgacatc
gatgccaacggcatcctgaacgtcacggccacggacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggcagagaagtacaaagcggaggacgaggtgcagcgcgagagggtgtcagccaagaac
gccctggagtcgtacgccttcaacatgaagagcgccgtggaggatgaggggctcaagggc
aagatcagcgaggccgacaagaagaaggtgctggacaagtgtcaagaggtcatctcgtgg
ctggatgccaacaccctggccgagaaggacgagtttgagcacaagaggaaggagctggag
caggtgtgtaaccccatcatcagcggactgtaccagggtgcaggtggtcctgggcctggc
ggcttcggggctcagggtcccaagggagggtctgggtcaggccccaccattgaggaggtg
gattag

DBGET integrated database retrieval system