KEGG   Macaca mulatta (rhesus monkey): 114672263
Entry
114672263         CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DNA damage-binding protein 2-like
  KO
K10140  DNA damage-binding protein 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03420  Nucleotide excision repair
mcc04115  p53 signaling pathway
mcc04120  Ubiquitin mediated proteolysis
mcc05161  Hepatitis B
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114672263
  09124 Replication and repair
   03420 Nucleotide excision repair
    114672263
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114672263
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114672263
   05202 Transcriptional misregulation in cancer
    114672263
  09162 Cancer: specific types
   05210 Colorectal cancer
    114672263
   05212 Pancreatic cancer
    114672263
   05225 Hepatocellular carcinoma
    114672263
   05226 Gastric cancer
    114672263
   05214 Glioma
    114672263
   05216 Thyroid cancer
    114672263
   05220 Chronic myeloid leukemia
    114672263
   05217 Basal cell carcinoma
    114672263
   05218 Melanoma
    114672263
   05213 Endometrial cancer
    114672263
   05224 Breast cancer
    114672263
   05222 Small cell lung cancer
    114672263
   05223 Non-small cell lung cancer
    114672263
  09172 Infectious disease: viral
   05161 Hepatitis B
    114672263
   05169 Epstein-Barr virus infection
    114672263
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    114672263
   03400 DNA repair and recombination proteins [BR:mcc03400]
    114672263
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     114672263
DNA repair and recombination proteins [BR:mcc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      114672263
SSDB
Motif
Pfam: HMw1_D2
Other DBs
NCBI-GeneID: 114672263
NCBI-ProteinID: XP_028689302
LinkDB
Position
14
AA seq 237 aa
MAPKKRPETQKTSEIVLRPRNKRSRSPRELEPEAKKLCAKGSGPSRRGDSDCLWAGLAGP
QILPPCHSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLESYRILQKAAPFDRRATSLAWH
PTHPQHCGCGSKGEISCSGIWHQGQTTFIKGAAWHPRYNLIVVGRYPDPNFKSCTPYEMR
TIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQEEARTRK
NT seq 714 nt   +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccgagattgtattacgccccagg
aacaagaggagcaggagtccccgggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagaggtgactcagactgcctctgggcggggctggctggccca
cagatcctgccgccatgccacagcatcgtcaggaccctccaccagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggaatct
taccggatattacaaaaggctgccccctttgacaggagggctacatccttggcgtggcac
ccgactcacccccagcactgtggctgtggttccaaaggggagatatcatgctctggaatt
tggcatcaaggacaaaccaccttcatcaaaggggcagcctggcatcctcgctacaacctc
attgttgtaggccgatacccagatcctaatttcaaaagttgtaccccctatgaaatgagg
acgatcgatgtgtttgatggaaactcagggaagatgatgtgtcagctctatgacccagaa
tcttctggcatcagttcgctcaatgagttcaatcccatgggggacacgctggcctctgca
atgggttaccacattctcatctggagccaggaggaagccaggacccggaaatga

KEGG   Macaca mulatta (rhesus monkey): 713813
Entry
713813            CDS       T01028                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03420  Nucleotide excision repair
mcc04115  p53 signaling pathway
mcc04120  Ubiquitin mediated proteolysis
mcc05161  Hepatitis B
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    713813 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    713813 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    713813 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    713813 (DDB2)
   05202 Transcriptional misregulation in cancer
    713813 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    713813 (DDB2)
   05212 Pancreatic cancer
    713813 (DDB2)
   05225 Hepatocellular carcinoma
    713813 (DDB2)
   05226 Gastric cancer
    713813 (DDB2)
   05214 Glioma
    713813 (DDB2)
   05216 Thyroid cancer
    713813 (DDB2)
   05220 Chronic myeloid leukemia
    713813 (DDB2)
   05217 Basal cell carcinoma
    713813 (DDB2)
   05218 Melanoma
    713813 (DDB2)
   05213 Endometrial cancer
    713813 (DDB2)
   05224 Breast cancer
    713813 (DDB2)
   05222 Small cell lung cancer
    713813 (DDB2)
   05223 Non-small cell lung cancer
    713813 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    713813 (DDB2)
   05169 Epstein-Barr virus infection
    713813 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    713813 (DDB2)
   03400 DNA repair and recombination proteins [BR:mcc03400]
    713813 (DDB2)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     713813 (DDB2)
DNA repair and recombination proteins [BR:mcc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      713813 (DDB2)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 713813
NCBI-ProteinID: NP_001247766
Ensembl: ENSMMUG00000022964
UniProt: F6ST49
LinkDB
Position
14
AA seq 427 aa
MAPKKRPETQKTSEIVLRPRNKRSRSPRELEPEAKKLCAKGSGPSRRGDSDCLWAGLAGP
QILPPCHSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRIYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYEMRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ
EEARTRK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccgagattgtattacgccccagg
aacaagaggagcaggagtccccgggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagaggtgactcagactgcctctgggcggggctggctggccca
cagatcctgccgccatgccacagcatcgtcaggaccctccaccagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggattct
taccggatattacaaaaggctgccccctttgacaggagggctacatccttggcgtggcac
ccgactcaccccagcactgtggctgtgggttccaaagggggagatatcatgctctggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtttttgccagctcagacaccatc
aacatctggttttgtagcctggatgtgtccgccagtagccgaatggtggtcacaggagac
aacgtggggaacgtgatcctgctgaacatggacggcaaagagctttggaatctcagaatg
cacaaaaagaaagtgacgcatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatctgggacctgcgccaggttagagggaaagccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagcttgtttcagtcccgatgga
gcccggctcctgaccacggaccagaagagcgagatccgaatttactctgcttcccagtgg
gactgccccctgggcctgatcccacaccctcaccgtcacttccagcacctcacacccatc
aaggcagcctggcatcctcgctacaacctcattgttgtaggccgatacccagatcctaat
ttcaaaagttgtaccccctatgaaatgaggacgatcgatgtgtttgatggaaactcaggg
aagatgatgtgtcagctctatgacccagaatcttctggcatcagttcgctcaatgagttc
aatcccatgggggacacgctggcctctgcaatgggttaccacattctcatctggagccag
gaggaagccaggacccggaaatga

DBGET integrated database retrieval system