KEGG   Macaca mulatta (rhesus monkey): 114672301
Entry
114672301         CDS       T01028                                 

Definition
(RefSeq) ETS domain-containing protein Elk-1-like isoform X1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04510  Focal adhesion
mcc04910  Insulin signaling pathway
mcc04912  GnRH signaling pathway
mcc04921  Oxytocin signaling pathway
mcc05140  Leishmaniasis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05213  Endometrial cancer
mcc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114672301
   04012 ErbB signaling pathway
    114672301
   04014 Ras signaling pathway
    114672301
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114672301
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114672301
   04912 GnRH signaling pathway
    114672301
   04921 Oxytocin signaling pathway
    114672301
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114672301
   05205 Proteoglycans in cancer
    114672301
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    114672301
   05213 Endometrial cancer
    114672301
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114672301
   05161 Hepatitis B
    114672301
   05163 Human cytomegalovirus infection
    114672301
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    114672301
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    114672301
SSDB
Motif
Pfam: Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 114672301
NCBI-ProteinID: XP_028689383
LinkDB
Position
14
AA seq 403 aa
MDPSVTLWQFLLQLLRQQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSHPEVAGCSTEDCAPQSEVSVTSAKPNAALAAVH
AAPGDTASGKPGTPKDAGRAGPSGLAHSRRNEYMGSGLYSTFTIQSLQPQPPPHPRPAVM
LPNAAPAGAAAPPSGSRSTSPSPFCLEAEEAGLPLQTILTPPEAPNLKSEGLNVEPGLGR
ALPPEVKVEGPKEELEVAGEGGFVPETTKAEPEIPPQEGVPARLPAVVMDTAKQAGGPAA
SSPEISQPQKGRKPQDLELPLSPSLLGGPGPERTPGSGTGSGLQVPGPALTPSLLPMHTL
TPVLLTPSSLPPSIHLWSTLSPIAPRSPAKLSFQFPTSGSAQV
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagctgctcagacagcaaggcaat
ggccacatcatctcctggacttcacgggatggtggtgaattcaagctggtggatgcagag
gaggtggcccggctgtgggggctacgcaagaacaagaccaacatgaattacgacaagctc
agccgggccttgcggtactactatgacaagaatatcatccgcaaagtgagcggccagaag
ttcgtttacaagtttgtgtcccatcctgaggtcgcagggtgctccactgaggactgcgcg
ccccagtcagaggtgtctgttacctccgccaagccaaatgcggcccttgctgctgtacat
gccgccccaggggacactgcctctggaaagccaggcacacccaaggatgcaggaagggca
ggcccgagcggtttggcacatagccgccggaacgagtacatgggctcgggcctctattcc
accttcaccatccagtctctgcagccacagccaccccctcatcctcggccggctgtgatg
ctccctaacgcagctcctgcaggagcagcagcgcccccctcggggagcaggagcaccagt
ccaagccccttttgcctggaggctgaggaggccggcttgcctctgcagaccatcctgacc
ccgcccgaggccccaaacctgaaatcggaagggctgaatgtggagccaggtttgggccgg
gctttgcccccggaagtgaaagtggaagggcccaaggaagagttggaagttgccggggag
ggagggtttgtgccggaaactactaaggccgagccagaaatccctccacaggagggcgtg
ccagcccggctgccggcggtcgttatggacaccgcaaagcaggcgggcggccccgcggct
tccagccctgagatctcccagccgcagaagggccggaagccccaggacctagagcttcca
ctcagcccgagcctgctaggtgggccaggacccgaacggaccccaggatcgggaactggc
tccggcctccaggtgcctgggccggcgctaactccgtccctacttcctatgcatacattg
accccagtgctgctgacacccagctcgctgcctcccagcattcacctctggagcaccctg
agtcccattgcgccccgtagcccggccaagctctccttccagtttccgaccagtggcagc
gcccaggtttga

KEGG   Macaca mulatta (rhesus monkey): 712610
Entry
712610            CDS       T01028                                 

Gene name
ELK1
Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04510  Focal adhesion
mcc04910  Insulin signaling pathway
mcc04912  GnRH signaling pathway
mcc04921  Oxytocin signaling pathway
mcc05140  Leishmaniasis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05213  Endometrial cancer
mcc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    712610 (ELK1)
   04012 ErbB signaling pathway
    712610 (ELK1)
   04014 Ras signaling pathway
    712610 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    712610 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    712610 (ELK1)
   04912 GnRH signaling pathway
    712610 (ELK1)
   04921 Oxytocin signaling pathway
    712610 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    712610 (ELK1)
   05205 Proteoglycans in cancer
    712610 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    712610 (ELK1)
   05213 Endometrial cancer
    712610 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    712610 (ELK1)
   05161 Hepatitis B
    712610 (ELK1)
   05163 Human cytomegalovirus infection
    712610 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    712610 (ELK1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    712610 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 712610
NCBI-ProteinID: NP_001244117
Ensembl: ENSMMUG00000019420
UniProt: F6R9C9
LinkDB
Position
X
AA seq 428 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAMPNVAPAAVH
ATPGDTASGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV
LPNAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL
GRALPPEVKVEGPKEELEVARERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH
VASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGTGSGLQAPGPALTPSLLPTH
TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV
LSPGPQKP
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagctgctgagagagcaaggcaat
ggccacatcatctcctggacttcacgggatggtggtgaattcaagctggtggatgcagag
gaggtggcccggctgtgggggctacgcaagaacaagaccaacatgaattacgacaagctc
agccgggccttgcggtactactatgacaagaacatcatccgcaaggtgagcggccagaag
ttcgtctacaagtttgtgtcctatcctgaggtcgcagggtgctccactgaggactgcccg
ccccagccagaggtgtctgttacctccgccatgccaaatgtggcccctgctgctgtacat
gccaccccaggggacactgcctctggaaagccaggcacacccaagggtgcaggaatggca
ggcccgggtggtttggcacgcagcagccggaacgagtacatgcgttcgggcctctattcc
accttcaccatccagtctctgcagccacagccaccccctcatcctcggcctgctgtggtg
ctccccaatgcagctcctgcaggagcagcagcgcccccctcggggagcaggagcaccagt
ccaagccccttggaggcctgcctggaggctgaggaagccggcttgcctctgcaggtcatc
ctgactccgcccgaggccccaaacctgaaatcggaagagctgaatgtggagccaggtttg
ggccgggctttgcccccagaagtgaaagtggaagggcccaaggaagagttggaagttgcc
agggagagagggtttgtgccggaaactaccaaggccgagccagaagtccctccacaggag
ggcgtgccagcccggctgcccgcggttgttatggacaccgcagggcaggcgggcggccac
gtggcttccagccctgagatctcccagccacaaaagggccggaagccccgggacctagag
cttccactcagcccaagcctgctaggtgggccaggacccgaacggaccccaggatcggga
actggctccggcctccaggcgcctgggccggcgctaactccatccctacttcctacacat
acattgaccccggtgctgctgacacccagctcgctgcctcccagcattcacttctggagc
accctgagtcccattgcgccccgtagcccggccaagctctccttccagtttccatccagt
ggcagcgcccaggtgcacatcccttccatcagcgtggatggcctctcgacccccgtggtg
ctctccccagggccccagaagccatga

DBGET integrated database retrieval system