KEGG   Macaca mulatta (rhesus monkey): 114673005
Entry
114673005         CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: nitric oxide synthase, inducible-like
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00220  Arginine biosynthesis
mcc00330  Arginine and proline metabolism
mcc01100  Metabolic pathways
mcc04020  Calcium signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04146  Peroxisome
mcc04371  Apelin signaling pathway
mcc04926  Relaxin signaling pathway
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05133  Pertussis
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05146  Amoebiasis
mcc05152  Tuberculosis
mcc05200  Pathways in cancer
mcc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    114673005
   00330 Arginine and proline metabolism
    114673005
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    114673005
   04066 HIF-1 signaling pathway
    114673005
   04020 Calcium signaling pathway
    114673005
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    114673005
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    114673005
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114673005
  09162 Cancer: specific types
   05222 Small cell lung cancer
    114673005
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114673005
   05014 Amyotrophic lateral sclerosis
    114673005
  09171 Infectious disease: bacterial
   05133 Pertussis
    114673005
   05152 Tuberculosis
    114673005
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    114673005
   05145 Toxoplasmosis
    114673005
   05140 Leishmaniasis
    114673005
   05142 Chagas disease
    114673005
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     114673005
SSDB
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 114673005
NCBI-ProteinID: XP_028691623
LinkDB
Position
16
AA seq 778 aa
MPSKLSQRCRDLVYGHLRGEPGNQPALVQGILECMVDSPVPHQTVHLEDLDESGEPWARE
SVLPGILWPPYLAEGLSLSLPISLGLTLHLWDMYLLEGEQVLMAITSIAFKVQRKGGLSG
RAGAVHNDTKPIPYMMQMKVGSVALEETDEHRSPGLREVWEEGQSIYWELRADVHLGTVQ
VLCMDKYRLRSCLDEAXLLLVVTSTSGNGDCASNGEKLKKSLFMLKELTNKFRYAVFVLS
SSRYPQFCAFAYDFNQKLSHLGASQLTLTWEEDELSGQEDAFLSRAVQNFKAACETFDVR
GKQHIQIPKLYTSSVTWDPHHYRLVQDSQPLDLSKALSNVHAKNVFTMRLKSRQNLQSPT
SSHTTILVEVSCEEGQGLNYLPGKHLGVCPGNQPALVQGILEQVVDSPAPHQTVRLEALD
ESNSYRFSDKRLPRCSLSQVLTYFLDITXPPAQLLLQKLAQVAIEEPERHRLEAVCQVKI
RAEYTKWKFTNSPTFLEVLEEFPSLWVSTGFLLSRLPILKPRFYSMSSSLDHTPTKIHLT
VAVVMSHTRDGQGPLHHGVCSTWLNSLKPRDPMPCFIRKAGPLFSCPLQLPEDPSHPCIL
VGPGTDIAPFRSFWQQRLHDSQHKGKAGGRRTLVFWCCRPGEDRTYREEMLEMTRKRVLH
AVHTXYSRLPGKPKVYVQDILRQQLASEVLRVLHEEPGHLYVCGDVRMAWDVAHTLKQLV
AAKLNLSEEQVEDYFFQLKSRKCFHEDTFGAVFTYKRTRRQRSPGACRCGPLTAHRRG
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgccgtccaagctgtcacagcgctgcagagatcttgtttatggccacttaagaggagaa
ccaggcaaccagccagccctggtccaaggcatcctggagtgtatggtggacagccctgtg
ccccaccagacagtgcacctggaggacctggatgagagtggtgagccctgggccagggag
tcagtgctacctggcatcctctggcccccctacctagctgaggggctgagcctgagcctg
ccgatctctcttgggctcaccctgcacctgtgggacatgtatttgctggaaggggaacag
gtgttgatggcaataacaagcattgcctttaaggttcagaggaagggaggtctgtccggg
agggctggagcagtgcacaatgacaccaagcccattccctacatgatgcagatgaaagtc
gggagtgtggcactggaagagacagatgagcacaggagccctggtctgagagaggtgtgg
gaggaaggccagagcatctactgggagctgagggctgatgtccacctgggtaccgtccag
gttctctgcatggacaagtacaggctgaggagctgcctggacgaggcatagctgttgttg
gtggtgaccagcacatctgggaatggagactgcgccagcaatggagagaaactgaagaaa
tccctcttcatgctgaaagagctcaccaacaaattcaggtatgccgtgtttgtcctcagc
tccagcaggtaccctcagttctgcgcctttgcttatgacttcaaccagaagctatcccac
ctgggggcctctcagctcaccctgacgtgggaagaggatgagctcagtgggcaggaggac
gccttcctcagcagggccgtgcaaaacttcaaggcagcctgtgagacatttgatgtccga
ggcaaacagcacattcagatccccaagctctacacctccagtgtgacctgggacccacac
cactacaggctcgtgcaggactcacagcctttggacctcagcaaagccctcagcaacgtg
cacgccaagaacgtgttcaccatgaggctcaaatctcggcagaacctacagagtccgaca
tccagccacaccaccatcctggtggaagtctcttgtgaggagggccaaggtctgaactac
ctgccagggaagcaccttggggtttgtccaggcaaccagccggccctggtccaaggcatc
ctggagcaagtggtggacagccccgcaccccaccagacagtgcgcctggaggccctggac
gagagcaacagctaccggttcagtgacaagaggctgccccgctgctcactcagccaagtc
ctcacctacttcctggatatcaccnaccccccagcccagctgctgctccaaaagttggcc
caggtggccatagaagagcctgagagacacaggctggaggccgtgtgccaggtgaagatc
agggctgagtacaccaagtggaagttcaccaatagccccacgttcctggaggtgctggag
gagttcccatccctgtgggtgtctactggcttcctgctctcccggctccccattctgaag
cccaggttctactccatgagctcctccctggatcacacgcccacaaagatccacctgact
gtggctgtggtgatgtcccacacccgggatggccagggtcccctgcaccacggcgtctgc
agcacatggctcaacagcctgaagccccgagacccaatgccctgctttatacgaaaggct
ggccccctcttctcctgtcctcttcagctccccgaggacccctcccatccttgcatcctc
gtcgggcctggcacagacatcgcccccttccgcagtttctggcagcagcggctccatgac
tcccagcacaagggtaaggctggaggccgcaggaccctggtcttctggtgctgccgccca
ggtgaggaccgcacctaccgcgaggagatgctggagatgacccggaagcgggtgctgcat
gcggtgcacacgntctattcccgcctgcctggcaagcccaaggtctatgttcaggacatc
ctgcggcagcagctggccagcgaggtgctccgtgtgctccatgaggagccgggccacctc
tatgtttgtggggatgtgcgcatggcctgggatgtcgcccacaccctgaagcagctggtg
gctgccaagctgaacttgagtgaggagcaggtcgaggactatttctttcagctcaagagc
cggaagtgctttcatgaagatacctttggtgctgtatttacctacaagcggacaaggcgg
cagcgcagccctggagcctgcagatgtgggcctctgacggcccacaggaggggttaa

DBGET integrated database retrieval system