KEGG   Macaca mulatta (rhesus monkey): 114674157
Entry
114674157         CDS       T01028                                 

Gene name
PPP1R12C
Definition
(RefSeq) LOW QUALITY PROTEIN: protein phosphatase 1 regulatory subunit 12C
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04270  Vascular smooth muscle contraction
mcc04510  Focal adhesion
mcc04810  Regulation of actin cytoskeleton
mcc04921  Oxytocin signaling pathway
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114674157 (PPP1R12C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114674157 (PPP1R12C)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    114674157 (PPP1R12C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114674157 (PPP1R12C)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    114674157 (PPP1R12C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    114674157 (PPP1R12C)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     114674157 (PPP1R12C)
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_4 Ank_5 Ank_3 Ank DUF4695
Other DBs
NCBI-GeneID: 114674157
NCBI-ProteinID: XP_028695795
LinkDB
Position
19
AA seq 782 aa
MSGEDGPAAGPGAAAAAARERRREQLRQWGARAGAESGPGERRARTVRFERAAEFLAACA
GGDLDEARLMLCAADPGPGAELDPAAPPPARAVLDSTNADGISALHQACIDENLEVVRFL
VEQGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAESDPME
GLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAAKGYI
EVMRLLLQAGYDPELRDGDGWTPLHAAAHWGVEDACRLLAEHGXGMDSLTHAGQRPCDLA
DEEVLSLLEELARKQEDLRNQKEASQSRGQEPQAPCSSRHRRSSVCRLSSREKISLQDLS
KERRPGGAGGPPIQDEDEGEEGPAEPRPAEPGTLNGVSSPPHPSPKSPVPPEEAPFSRRF
GLLKTGSSGALGPPERRMAEGAPGAGLQRSASSSWLEGTSTQARELRLARITPTPSRKLP
EPSVLSEVTKPPPCLENSSPPSRIPESESPAKPNAPTASTAPPADSRDRRRSYQMPVRDE
ESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKSAGKAPESEKLAQSLDPSRRPRVPGVE
NSDSPAQRAEAPDGQGPGPQAAREPRKVGKEWRGPAEGEEAEPADRSPESSTLEGGPSAR
RQRSQRDLHPEPEPESEEQDGGFRKLYAELRRENERLREALTETTLRLAQLKVELERATQ
RQERFAERPALLELERFERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVISKL
SK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgtcgggagaggatggcccggcggctggcccgggggcggcggcggcggctgcccgggag
cggcgacgggagcagctgcggcagtggggggcgcgggcgggcgccgagtctggccccgga
gagcgccgcgcccgcaccgtccgcttcgagcgcgccgccgagttcctggcggcctgtgcg
ggcggcgacctcgatgaagcgcgtctgatgctgtgcgccgccgaccctggccccggcgcc
gagctcgaccccgccgcgccgccgcccgcccgcgcagtgctggactccaccaacgccgac
ggcatcagcgccctgcaccaggcctgcattgatgagaacctggaggtggtgcgcttcttg
gtggagcaaggcgccactgtgaaccaggcggacaacgagggctggacgcccctgcatgtg
gctgcctcctgtggctacctagacatcgccaggtacctcctgagccacggggccaacatc
gccgccgtcaacagtgacggggacctgcccctggacctggccgagtcggaccccatggag
gggctgctgaaggcggagatcgcccgccgaggtgtggacgtggaggcagccaagcgggcg
gaggaggaattgctacttcatgacacaaggtgctggctgaatgggggagccatgccagag
gcccggcacccccgcacaggcgcctctgccctgcacgtggctgctgccaagggctacatt
gaggtgatgaggttgctccttcaggctggctacgacccggagctccgggacggggacggc
tggacccccctgcacgcggcggcacactggggcgtggaggacgcctgccgcctgctggcc
gagcacggcnggggcatggactcgctgacccacgcggggcagcggccctgtgacctggct
gatgaggaagtgctgagcctgttggaggaactggcccggaaacaggaagaccttcggaac
caaaaagaagcttcccagagccggggccaggagccccaagcgccctgtagcagcagacac
agaaggagctctgtgtgtcgtctgagcagtcgagagaagatttccctccaggacttgtcc
aaggagcgccggcctggtggggctggggggccccccatccaggacgaggatgagggggaa
gaaggtcccgccgagccacgccctgcagagcccggaaccctcaatggcgtctcctcccca
ccgcacccgagtcctaagagccccgtgccgcctgaagaggcccccttctccaggcgcttt
ggcctcctgaagacagggagttctggtgccctgggtcccccggaaaggcggatggcagag
ggagccccgggggctgggctgcagcgctcggcttcctcctcctggctggaagggacctcc
acccaggccagggagctccgtcttgccagaattaccccgaccccctcccggaagctgccg
gagccctctgtcctgtctgaggtcaccaagcctcctccttgcttggagaactcctcgcct
ccctccaggattccggagtctgaatctccagcgaagccaaatgcccccaccgcctccaca
gcacccccagcggactcccgggaccgacggaggtcctaccagatgcctgtgcgggatgag
gagtcggaatcccagagaaaagctcgctcccgtctcatgcgccagtctcggaggtccacg
cagggtgtgactctgacagacctgaaggaggcagagaagtctgcagggaaggccccagag
tcagagaagctggcgcagagcctggacccttcccggaggccccgcgtccctggagtggag
aactccgacagcccggcccagagagcagaggcgcctgacgggcagggtccaggaccgcag
gcggccagggagccccgcaaggtcggaaaggagtggagggggcctgcggagggggaggag
gcggagccggctgaccgcagcccggagtccagcaccctggagggcggcccctcggcccgc
aggcagcggtcacagcgggacctccacccagaacctgagccagagtcggaggagcaggac
ggaggctttaggaagctgtatgcagagctgcgcagggagaacgagcggcttcgcgaggct
ctgaccgagaccacgctgcggctggcgcagctcaaggtggagctggagcgggccacgcag
aggcaagagcgcttcgctgagaggccagcgcttctggagctggagagattcgagcgcagg
gccctggaacgcaaggctgcagagctggaggaagagctgaaggccctgtctgacctccgc
gctgacaaccagcgcctcaaggatgagaatgcagcgttgatccgcgttatcagcaaactc
tccaagtga

KEGG   Macaca mulatta (rhesus monkey): 695735
Entry
695735            CDS       T01028                                 

Gene name
PPP1R12A
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12A
  KO
K06270  protein phosphatase 1 regulatory subunit 12A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04510  Focal adhesion
mcc04611  Platelet activation
mcc04810  Regulation of actin cytoskeleton
mcc04921  Oxytocin signaling pathway
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    695735 (PPP1R12A)
   04022 cGMP-PKG signaling pathway
    695735 (PPP1R12A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    695735 (PPP1R12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    695735 (PPP1R12A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    695735 (PPP1R12A)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    695735 (PPP1R12A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    695735 (PPP1R12A)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    695735 (PPP1R12A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    695735 (PPP1R12A)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     695735 (PPP1R12A)
SSDB
Motif
Pfam: Ank_2 Ank_4 PRKG1_interact Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 695735
NCBI-ProteinID: NP_001253022
Ensembl: ENSMMUG00000019214
UniProt: I0FRY0
LinkDB
Position
11
AA seq 1029 aa
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSP
LIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDEEEEGKKDESSCSSEED
EEDDSESEAETDKTKPLASVTNANTSTTQAAPVAVTTPTVSSGQATPTSPIKKFPTTATK
ISPKEEERKDESPATWRLGLRKTGSYGALAEITASKEGQKEKDTAGVTRSASSPRLSSSL
DNKEKEKDSKGTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKN
SSINEGSTYHKSCSFGRRQDDLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGS
SSAGTQSSTSNRLWAEDSTEKEKDSVPTAVTIPVAPTVVNAAASTTTLTTTTAGTVSSTT
EVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTR
EQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYRPVSTSSSATP
SSSLSTMSSSLYASSQLNRPNSLVGITSYSRGITKENEREGEKREEEKEGEDKSQSKSIR
ERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDRY
DSLLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDLK
LQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGAL
IRVISKLSK
NT seq 3090 nt   +upstreamnt  +downstreamnt
atgaagatggcggacgcgaagcagaagcggaacgagcagctgaagcgctggatcggctcc
gagacggacctcgagcctccggtggtgaagcgccagaagaccaaggtgaagttcgacgat
ggcgccgtcttcctggctgcttgctccagcggggacacggacgaggtcctcaagctgctg
caccgcggcgccgacatcaattacgccaatgtggacggactcactgccctgcaccaggct
tgcattgatgacaatgttgatatggtgaagtttctggtagaaaatggagcaaatattaat
caacctgataatgaaggctggataccactacatgcagcagcttcctgtggatatcttgat
attgcagagtttttgattggtcagggagcacatgtaggggctgtcaacagtgaaggagac
acacctttagatattgcggaggaggaggcaatggaagagctacttcaaaatgaagttaat
cggcaaggggttgatatagaagcagctcgaaaggaagaagaacggatcatgcttagagat
gccaggcagtggctaaatagtggtcatataaatgatgtccggcatgcaaaatctggaggt
acagcactccacgttgcagctgctaaaggctatacggaagttttaaaacttttaatacag
gcaggctatgatgttaatattaaagactatgatggctggacacctcttcatgctgcagct
cattggggtaaagaagaagcatgtcgaattttagtggacaatctatgtgatatggagatg
gtcaacaaagtgggccagacagcctttgatgtagcagatgaagacattttaggatattta
gaagagttgcaaaagaaacaaaatctgctccatagtgaaaaacgggacaagaaatctccg
ttaattgaatcaacagcaaatatggacaataatcagtcacagaagacctttaaaaacaaa
gagacattgattattgaaccagagaaaaatgcatcccgtattgaatctctggaacaagaa
aaggttgatgaagaagaagaaggaaagaaagatgagtctagctgctctagtgaagaagat
gaggaagatgactcggaatcagaagctgaaacagataagacaaaacccctggcttctgta
actaatgccaacacttctactacacaagcagctcctgtagctgttacaacacctactgtg
tcatcaggtcaagcaacacctacatcacctattaaaaagtttccaaccacagctacaaaa
atttctcccaaagaagaagagagaaaagatgagtctcctgcaacttggaggttaggactt
agaaagacgggcagctatggtgcacttgctgaaatcacagcatctaaagagggtcagaaa
gaaaaagatactgcaggtgttacacgttcagcttcaagtcccagactttcctcctctttg
gataataaagaaaaggagaaagatagtaaaggaactaggcttgcatatgttgcacctaca
ataccaagacgactagccagtacatctgacattgaagagaaagaaaacagagattcttca
agtttgcgaacaagtagttcatatacaaggagaaaatgggaagatgatcttaaaaaaaat
agctcaattaatgaaggatcaacttatcataaaagttgctcctttggtagaagacaagat
gatttgattagttctagtgttccaagcaccacatcaacaccaacagttacctctgcagct
gggcttcagaaaagcctgctttccagcacaagcactactacaaagattacaacgggttct
tcctcagcaggcacacaaagcagtacctcaaatcgtttgtgggctgaggatagtactgaa
aaagaaaaggacagtgttcctacggcagtgaccattcctgttgctccaactgttgtaaat
gctgcagcttctaccacaaccctgactacaactactgctggcactgtctcctccacaaca
gaggtcagggagagacgcagatcatacctcactcctgttagggatgaagagtctgaatcc
caaagaaaagcaagatctagacaagcaagacaatccagaagatcaacacagggagtgaca
ttaactgatcttcaagaagctgagaaaaccataggaagaagtcgttctacccgaaccaga
gaacaagaaaatgaagaaaaagaaaaagaggaaaaagaaaaacaagataaagagaaacaa
gaagaaaagaaggagtcagaaacatctagagaagacgaatataaacaaaaatactccaga
acgtatgatgagacttaccagcgttataggccagtatcaacttcaagttcagccactcca
tcctcttcactttctactatgagcagttcactctatgcttcaagtcaactaaacaggcca
aatagtcttgtaggcataacttcttactccagaggaataacaaaagaaaatgaaagagag
ggagaaaaaagagaagaggaaaaagaaggagaagataaatcacaatctaaatcaattaga
gaacgacggcgaccaagagagaaaagaagatctacaggagtttcattttggacacaagat
agtgatgaaaatgaacaagaacaacaatcagacacagaagagggatccaataagaaagaa
actcagacggattccatttctagatatgaaaccagttctacatcagctggtgatcgatat
gattccttgctgggtcgctctggatcatacagttacttagaagaaagaaaaccttacagc
agcaggctagaaaaggatgactcaactgactttaaaaagctttatgaacaaattctcgct
gaaaatgaaaagctgaaggcacagctacatgatacaaatatggaactaacagatcttaaa
ttacagttggaaaaggccacccagagacaagaaagatttgctgataggtcactgttggaa
atggaaaaaagggaacgaagagctctagaaagaagaatatctgaaatggaagaagagctc
aaaatgttaccagacctaaaagcagacaaccagaggctaaaggatgaaaatggggccttg
atcagagttataagcaaactttccaaataa

KEGG   Macaca mulatta (rhesus monkey): 698538
Entry
698538            CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: protein phosphatase 1 regulatory subunit 12C
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04270  Vascular smooth muscle contraction
mcc04510  Focal adhesion
mcc04810  Regulation of actin cytoskeleton
mcc04921  Oxytocin signaling pathway
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    698538
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    698538
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    698538
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    698538
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    698538
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    698538
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     698538
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_4 Ank_5 Ank_3 Ank DUF4695
Other DBs
NCBI-GeneID: 698538
NCBI-ProteinID: XP_014980403
Ensembl: ENSMMUG00000021965
LinkDB
Position
19
AA seq 782 aa
MSGEDGPAAGPGAAAAAARERRREQLRQWGARAGAEPGPGERRARTVRFERAAEFLAACA
GGDLDEARLMLCAADPGPGAELDPAAPPPARAVLDSTNADGISALHQACIDENLEVVRFL
VEQGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAESDPME
GLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAAKGYI
EVMRLLLQAGYDPELRDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRPCDLA
DEEVLSLLEELARKQEDLRNQKEASQSRGQEPXAPCSSRHRRSSVCRLSSREKISLQDLS
KERRPGGAGGPPXQDEDEGEEGPAEPRPAEPGTLNGVSSPPHPSPKSPVPPEEAPFSRRF
GLLKTGSSGALGPPERRMAEGAPGAGLQRSASSSWLEGTSTQARELRLARITPTPSRKLP
EPSVLSEVTKPPPCLENSSPPSRIPESESPAKPNAPTASTAPPADSRDRRRSYQMPVRDE
ESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKSAGKAPESEKLAQSLDPSRRPRVPGVD
NSDSPAQRAEAPDGQGPGPQAAREPRKVGKEWRGPAEGEEAEPADRSPESSTLEGGPSAR
RQRSQRDLHPEPEPESEEQDGGFRKLYAELRRENERLREALTETTLRLAQLKVELERATQ
RQERFAERPALLELERFERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVISKL
SK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgtccggagaggatggcccggcggctggcccgggggcggcggcggcggctgcccgggag
cggcgacgggagcagctgcggcagtggggggcgcgggcgggcgccgagcctggccccgga
gagcgccgcgcccgcaccgtccgcttcgagcgcgccgccgagttcctggcggcctgtgcg
ggcggcgacctggacgaagcgcgtctgatgctgtgcgccgccgaccctggccctggcgcc
gagctcgaccccgccgcgccgccgcccgcccgcgcagtgctggactccaccaacgccgac
ggcatcagcgccctgcaccaggcctgcattgatgagaacctggaggtggtgcgcttcttg
gtggagcaaggcgccactgtgaaccaggcggacaacgagggctggacgcccctgcatgtg
gctgcctcctgtggctacctagacatcgccaggtacctcctgagccacggggccaacatc
gccgccgtcaacagtgacggggacctgcccctggacctggccgagtcggaccccatggag
gggctgctgaaggcggagatcgcccgccgaggtgtggacgtggaggcagccaagcgggcg
gaggaggaattgctacttcatgacacaaggtgctggctgaatgggggcgccatgccagag
gcccggcacccccgcacaggcgcctctgccctgcacgtggctgctgccaagggctacatt
gaggtgatgaggttgctccttcaggctggctacgacccggagctccgggacggggacggc
tggacccccctgcacgcggcggcgcactggggcgtggaggacgcctgccgcctgctggcc
gagcacggcgggggcatggactcgctgacccacgcggggcagcggccctgtgacctggct
gatgaggaagtgctgagcctgttggaggaactggcccggaaacaggaagaccttcggaac
caaaaagaagcttcccagagccggggccaggagcccnaagcgccctgtagcagcagacac
agaaggagctctgtgtgtcgtctgagcagtcgagagaagatttccctccaggacttgtcc
aaggagcgccggcctggtggggctggggggcccccantccaggacgaggatgagggggaa
gaaggtcccgccgagccacgccctgcagagcccggaaccctcaatggcgtctcctcccca
ccgcacccgagtcctaagagccccgtgccgcctgaagaggcccccttctccaggcgcttt
ggcctcctgaagacagggagttctggtgccctgggtcccccggaaaggcggatggcagag
ggagccccgggggctgggctgcagcgctcggcttcctcctcctggctggaagggacctcc
acccaggccagggagctccgtcttgccagaattaccccgaccccctcccggaagctgccg
gagccctctgtcctgtctgaggtcaccaagcctcctccttgcttggagaactcctcgcct
ccctccaggattccggagtctgaatctccagcgaagccaaacgcccccaccgcctccaca
gcacccccagcggactcccgggaccgacggaggtcctaccagatgcctgtgcgggatgag
gagtcggaatcccagagaaaagctcgctcccgtctcatgcgccagtctcggaggtccacg
cagggtgtgactctgacagacctgaaggaggcagagaagtctgcagggaaggccccagag
tcagagaagctggcgcagagcctggacccttcccggaggccccgcgtccctggagtggac
aactccgacagcccggcccagagagcagaggcgcctgacgggcagggtccaggaccgcag
gcggccagggagccccgcaaggtcggaaaggagtggagggggcctgcggagggggaggag
gcggagccggctgaccgcagcccggagtccagcaccctggagggcggcccctcggcccgc
aggcagcggtcacagcgggacctccacccagaacctgagccagagtcggaggagcaggac
ggaggctttaggaagctgtatgcagagctgcgcagggagaacgagcggcttcgcgaggct
ctgaccgagaccacgctgcggctggcgcagctcaaggtggagctggagcgggccacgcag
aggcaagagcgcttcgctgagaggccagcccttctggagctggagagattcgagcgcagg
gccctggaacgcaaggctgcagagctggaggaagagctgaaggccctgtctgacctccgc
gctgacaaccagcgcctcaaggatgagaatgcagcgttgatccgcgttatcagcaaactc
tccaagtga

KEGG   Macaca mulatta (rhesus monkey): 703302
Entry
703302            CDS       T01028                                 

Gene name
PPP1CB
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03015  mRNA surveillance pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04390  Hippo signaling pathway
mcc04510  Focal adhesion
mcc04611  Platelet activation
mcc04720  Long-term potentiation
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04931  Insulin resistance
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05168  Herpes simplex virus 1 infection
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    703302 (PPP1CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    703302 (PPP1CB)
   04024 cAMP signaling pathway
    703302 (PPP1CB)
   04022 cGMP-PKG signaling pathway
    703302 (PPP1CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    703302 (PPP1CB)
   04218 Cellular senescence
    703302 (PPP1CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    703302 (PPP1CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    703302 (PPP1CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    703302 (PPP1CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    703302 (PPP1CB)
   04921 Oxytocin signaling pathway
    703302 (PPP1CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    703302 (PPP1CB)
   04270 Vascular smooth muscle contraction
    703302 (PPP1CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    703302 (PPP1CB)
   04720 Long-term potentiation
    703302 (PPP1CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    703302 (PPP1CB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    703302 (PPP1CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    703302 (PPP1CB)
   05034 Alcoholism
    703302 (PPP1CB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    703302 (PPP1CB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    703302 (PPP1CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    703302 (PPP1CB)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mcc03021]
    703302 (PPP1CB)
   03019 Messenger RNA biogenesis [BR:mcc03019]
    703302 (PPP1CB)
   03041 Spliceosome [BR:mcc03041]
    703302 (PPP1CB)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     703302 (PPP1CB)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     703302 (PPP1CB)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     703302 (PPP1CB)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     703302 (PPP1CB)
Spliceosome [BR:mcc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    703302 (PPP1CB)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 703302
NCBI-ProteinID: NP_001247581
Ensembl: ENSMMUG00000044809
UniProt: H9FWD0
LinkDB
Position
13
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggacggggagctgaacgtggacagcctcatcacccggctgctggaggtacgagga
tgtcgtccaggaaagattgtgcagatgactgaagcagaagttcggggcttatgtatcaag
tctcgggagatctttctcagccagcctattcttttggaattggaagcaccgctgaaaatt
tgtggagatattcatggacaatatacggatttactgagattatttgaatatggaggtttc
ccaccagaagccaactatcttttcttaggagattatgtggacagaggaaagcagtctttg
gaaaccatttgtttgctattggcttataaaatcaaatatccagagaacttctttctctta
agaggaaaccatgagtgtgctagcatcaatcgcatttatggattctatgatgagtgcaaa
cgaagatttaatattaaattgtggaagaccttcactgattgttttaactgtctgcctata
gcagccattgtggatgagaagatcttctgttgtcatggaggattgtcaccagacctgcaa
tctatggagcagattcggagaattatgagacctactgatgtccctgatacaggtttgctc
tgtgatctgctatggtctgatccagataaggatgtgcaaggctggggagaaaatgatcgt
ggtgtttcctttacttttggagctgatgtagtcagtaaatttctgaatcgtcatgattta
gatttgatttgtcgagctcatcaggtggtggaagatggatatgaattttttgctaaacga
cagttggtaaccttattttcagccccaaattactgtggcgagtttgataatgctggtgga
atgatgagtgtggatgaaactttgatgtgttcatttcagatattgaaaccatctgaaaag
aaagctaagtaccagtatggtggactgaattctggacgtcctgtcactccacctcgaaca
gctaatccaccgaagaaaaggtga

KEGG   Macaca mulatta (rhesus monkey): 705775
Entry
705775            CDS       T01028                                 

Gene name
PPP1R12B
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12B isoform X6
  KO
K12329  protein phosphatase 1 regulatory subunit 12B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04270  Vascular smooth muscle contraction
mcc04510  Focal adhesion
mcc04810  Regulation of actin cytoskeleton
mcc04921  Oxytocin signaling pathway
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    705775 (PPP1R12B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    705775 (PPP1R12B)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    705775 (PPP1R12B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    705775 (PPP1R12B)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    705775 (PPP1R12B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    705775 (PPP1R12B)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     705775 (PPP1R12B)
SSDB
Motif
Pfam: PRKG1_interact Ank_4 Ank_2 Ank_5 Ank Ank_3 MEDS
Other DBs
NCBI-GeneID: 705775
NCBI-ProteinID: XP_001106168
Ensembl: ENSMMUG00000003998
UniProt: H9EUQ6
LinkDB
Position
1
AA seq 982 aa
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGA
VFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQLLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEM
LQKKQNVLRSEKETRNKLIESDLNSKMQSGFFKNKEKMLYEEETPKSQEMEEENKESSSS
SSEEEEGEDEASESETEKEAGKKPETFVNHSNSESKSSITEQIPAPAQNTFSASSARRFS
SGLFNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPLRDRGSSIYRSSSSPRISAL
LDNKDKERENKSYISSLAPRKLNSTSDIEEKENRESAVNLVRSGSYTRQLWRDEAKGNET
PQTIAPSTYVSTYLKRTPHKSQADSIAEKTADNVSSSTPLCVITNRPLPSTANGVTATPV
LSITGTDSSVEAREKRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAERT
FSRSRAERQAQEQPCEKPTDTEGLEGSPEKHEPSAVPATEAGEGQQPWGRSLDEEPICHR
LRCPTQPDKPTTPASPSTSRPSLYTSSHLLWTNRFSVPDSESSKTTTNTTTAKEMDKNEN
QEADLDEQYSRRLSVRERRRPKERRRGTGINFWTKDEDETDGSEEVKETWHERLSRLESG
GSNPTTSDSYGDRASARARREAREARLATLTSRVEEDSNRDYKKLYESALTENQKLKTKL
QEAQLELADIKSKLEKVTQQKQEKTSDRSSVLEMEKRERRALERKMSEMEEEMKVLTELK
SDNQRLKDENGALIRVISKLSK
NT seq 2949 nt   +upstreamnt  +downstreamnt
atggcggagctggagcacctaggagggaagcgggcagagtcggcgcgaatgcggcgggca
gagcagcttcggcgctggcggggctcgctgacagagcaggagcccgcggagcgacgaggc
gcggggcggcagccgctgaccaggcgcgggagccccagggtccgcttcgaggacggtgct
gtcttcctggccgcctgctctagcggggacaccgacgaggtgagaaagcttctggcaaga
ggtgctgatatcaacacagtcaacgtggacggcttgacagccctgcaccaggcatgtatt
gatgaaaatttggatatggtgaagtttctggtggagaacagagccaatgtaaaccagcaa
gacaacgaaggctggacaccccttcatgcagcagcttcctgtggctatctcaacatagca
gagtatttcattaatcacggagccagtgtaggtattgtcaacagtgaaggtgaagttccc
tctgaccttgcagaagagccagccatgaaggatcttcttctggagcaagtaaagaagcaa
ggagtcgatctagagcagtcaagaaaagaagaagagcagcagttgttgcaggatgcccgc
cagtggctcaacagtgggaaaatagaggatgtgaggcaggctcgctcaggagctacagcc
cttcatgtggctgctgccaagggctactctgaagtcctcagacttttaatacaggctggc
tatgaactcaatgttcaggattatgatggctggactcccctccatgctgctgcacactgg
ggagtgaaggaggcttgctccatcctggcagaagcactctgtgacatggatattcgaaac
aaactgggccagacaccatttgatgtggctgatgagggtctcgtggagcatttggagatg
ctccagaagaagcagaatgtgcttcgaagtgaaaaggagacacggaataaactcattgag
tcagacctgaacagcaagatgcagagtgggttctttaagaacaaagagaagatgctttat
gaggaggagacacctaagtcccaagaaatggaggaagagaacaaagaatctagtagctcc
agctcagaggaggaggaaggtgaagatgaagcttctgagtcagaaactgagaaggaggca
ggtaaaaagccggaaacctttgtcaaccattccaactccgaaagcaagagtagcatcacg
gagcagataccagcaccagctcagaataccttctctgcctcttctgctaggaggttctct
tctggcctttttaacaagccagaagagcccaaagatgaatctccttcttcgtggagattg
ggactgagaaaaactggcagccacaacatgctgagtgaggtggccaattccagggaacct
ctaagggaccgaggctcttccatctaccgttcctcttcaagccctcggatttctgctcta
ctagacaacaaagataaggagagagaaaacaaaagctatattagttcactagcaccccgg
aagctcaacagcacaagtgatattgaagaaaaggagaacagagaatcagctgttaatcta
gtgaggagtggctcctatacccggcagctatggagggatgaagcaaagggaaatgaaacc
ccacagacaattgccccctccacctatgtatcaacctacttgaaaaggactcctcacaaa
tcccaggctgactcgatagcagagaaaacagcagacaatgtctcttctagcaccccgctc
tgtgtgatcaccaatcgccctctgcctagcactgccaatggggttacagctactcctgta
ctctccattactggaacagattcctctgtggaagccagggagaagaggaggtcctatcta
actcctgtacgggatgaggaagcagagtctttacggaaagcacgctccagacaagctcgg
cagacacgaaggtctactcaaggtgtcaccctaacggaccttcaggaagcagaaaggact
ttcagccggtcgagggcagagaggcaagctcaggagcagccttgtgagaagcccacagac
actgaagggcttgaggggagccctgagaagcatgagccctcagcagttccagcaacagaa
gctggggagggccagcagccctggggcaggagtctggatgaagagcctatctgtcatcgc
ctgaggtgcccaactcagccagacaaacccaccacgccagcatctccttctacatcaaga
ccctcactctacaccagttcccatctgctatggacaaatagattttcagtccctgattct
gagagttcaaagactaccacaaatactacaactgcaaaggaaatggacaaaaatgagaat
caagaagcagatttggatgagcagtattctagaaggctgtccgtcagagagaggaggcgg
cccaaggaacgacgaagaggtacaggcatcaatttctggacaaaggatgaggatgaaact
gatggctctgaagaggtcaaagaaacatggcatgaaagactttctaggttggaatcagga
ggtagtaatcctacaaccagtgattcttacggtgaccgggcttcagcaagagcccgtcgg
gaggcccgggaggcccgtctagccaccctgaccagtcgtgtagaagaagacagcaacaga
gattataaaaaactctatgagagtgctctgactgaaaaccaaaaactgaaaacaaaactt
caggaagcccagctagagctagcagatataaaatccaagcttgagaaggtgacccagcag
aaacaagaaaagacctctgaccgatcatcagtgctggagatggagaaacgggagaggcga
gccttggagcgcaaaatgtcagaaatggaggaagaaatgaaggtgttaacagaactgaaa
tccgacaaccagaggctgaaagatgaaaatggtgccctcatcagagtcatcagcaaactg
tccaaatag

KEGG   Macaca mulatta (rhesus monkey): 709935
Entry
709935            CDS       T01028                                 

Gene name
PPP1CC
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03015  mRNA surveillance pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04390  Hippo signaling pathway
mcc04510  Focal adhesion
mcc04611  Platelet activation
mcc04720  Long-term potentiation
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04931  Insulin resistance
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05168  Herpes simplex virus 1 infection
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    709935 (PPP1CC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    709935 (PPP1CC)
   04024 cAMP signaling pathway
    709935 (PPP1CC)
   04022 cGMP-PKG signaling pathway
    709935 (PPP1CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    709935 (PPP1CC)
   04218 Cellular senescence
    709935 (PPP1CC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    709935 (PPP1CC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    709935 (PPP1CC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    709935 (PPP1CC)
  09152 Endocrine system
   04910 Insulin signaling pathway
    709935 (PPP1CC)
   04921 Oxytocin signaling pathway
    709935 (PPP1CC)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    709935 (PPP1CC)
   04270 Vascular smooth muscle contraction
    709935 (PPP1CC)
  09156 Nervous system
   04728 Dopaminergic synapse
    709935 (PPP1CC)
   04720 Long-term potentiation
    709935 (PPP1CC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    709935 (PPP1CC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    709935 (PPP1CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    709935 (PPP1CC)
   05034 Alcoholism
    709935 (PPP1CC)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    709935 (PPP1CC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    709935 (PPP1CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    709935 (PPP1CC)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mcc03021]
    709935 (PPP1CC)
   03019 Messenger RNA biogenesis [BR:mcc03019]
    709935 (PPP1CC)
   03041 Spliceosome [BR:mcc03041]
    709935 (PPP1CC)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     709935 (PPP1CC)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     709935 (PPP1CC)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     709935 (PPP1CC)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     709935 (PPP1CC)
Spliceosome [BR:mcc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    709935 (PPP1CC)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 709935
NCBI-ProteinID: NP_001244760
Ensembl: ENSMMUG00000013664
UniProt: H9YUD3
LinkDB
Position
11
AA seq 323 aa
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRGMITKQAKK
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcggatttagacaaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagcctggtaagaacgtccagcttcaggagaatgaaatcagaggactgtgttta
aaatctcgtgaaatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgacatccatgggcaatactatgatttgctgcgactttttgagtacggtggt
ttcccgccagaaagcaactacctgtttcttggggactatgtggacaggggaaagcagtca
ttggagacgatctgcctcttactggcctacaaaatcaaatatcctgagaatttttttctt
ctcagagggaaccatgaatgtgccagcatcaacagaatttatggattttatgatgaatgt
aaaagaagatacaacattaaactatggaaaactttcacagactgttttaactgtttaccg
atagcagccatcgtggatgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgaattttttgcaaag
aggcagttggtcactctgttttctgcgcccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggatgaaacactaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccaaatgccacgagacctgtaacgcctccaaggggtatgatcacaaagcaa
gcaaagaaatag

KEGG   Macaca mulatta (rhesus monkey): 721735
Entry
721735            CDS       T01028                                 

Gene name
PPP1CA
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-alpha catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03015  mRNA surveillance pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04390  Hippo signaling pathway
mcc04510  Focal adhesion
mcc04611  Platelet activation
mcc04720  Long-term potentiation
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04931  Insulin resistance
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05168  Herpes simplex virus 1 infection
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    721735 (PPP1CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    721735 (PPP1CA)
   04024 cAMP signaling pathway
    721735 (PPP1CA)
   04022 cGMP-PKG signaling pathway
    721735 (PPP1CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    721735 (PPP1CA)
   04218 Cellular senescence
    721735 (PPP1CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    721735 (PPP1CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    721735 (PPP1CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    721735 (PPP1CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    721735 (PPP1CA)
   04921 Oxytocin signaling pathway
    721735 (PPP1CA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    721735 (PPP1CA)
   04270 Vascular smooth muscle contraction
    721735 (PPP1CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    721735 (PPP1CA)
   04720 Long-term potentiation
    721735 (PPP1CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    721735 (PPP1CA)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    721735 (PPP1CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    721735 (PPP1CA)
   05034 Alcoholism
    721735 (PPP1CA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    721735 (PPP1CA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    721735 (PPP1CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    721735 (PPP1CA)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mcc03021]
    721735 (PPP1CA)
   03019 Messenger RNA biogenesis [BR:mcc03019]
    721735 (PPP1CA)
   03041 Spliceosome [BR:mcc03041]
    721735 (PPP1CA)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     721735 (PPP1CA)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     721735 (PPP1CA)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     721735 (PPP1CA)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     721735 (PPP1CA)
Spliceosome [BR:mcc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    721735 (PPP1CA)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 721735
NCBI-ProteinID: XP_002799514
Ensembl: ENSMMUG00000017278
UniProt: F7GWK7
LinkDB
Position
14
AA seq 330 aa
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtccgatagcgagaagctcaaccttgactcgatcatcgggcgcctgctagaagtgcag
ggctcgcggcctggcaagaatgtacagctgacagagaacgagatccgcggcctgtgcctg
aaatcccgggagattttcctgagccagcccattcttctggagctggaggcacccctcaag
atctgcggtgatatacacggccagtactatgaccttctgcgactatttgagtatggcggt
ttccctccggagagcaactacctctttctgggggactatgtggacaggggcaagcagtcc
ttggagaccatctgcctgctgctggcctataagatcaagtaccccgagaacttcttcctg
ctccgtgggaaccacgagtgcgccagcatcaaccgcatctacggtttctacgatgagtgc
aagagacgctacaacatcaaactgtggaaaacgttcactgactgcttcaactgcctgccc
attgcggccatagtggacgaaaagatcttttgctgccacggaggcctctccccggacctg
cagtccatggagcagattcggcggatcatgcggcccacagacgtgcctgaccagggcctg
ctgtgtgacctgctgtggtctgaccctgacaaggacgtgcagggctggggcgagaacgac
cgtggcgtctcttttacctttggagccgaggtggtggccaagttcctccacaagcatgac
ttggacctcatctgccgagcacaccaggtggtagaagatggctatgagttctttgccaag
cggcagctggtgacacttttctcagctcccaactactgtggcgagtttgacaatgctggc
gccatgatgagcgtggacgagaccctcatgtgctccttccagatcctcaagcccgccgac
aagaacaaggggaagtacgggcagttcagtggcctgaaccctggaggccggcccatcacc
ccaccccgcaattccgccaaagccaagaaatag

DBGET integrated database retrieval system