KEGG   Macaca mulatta (rhesus monkey): 114675335
Entry
114675335         CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04068  FoxO signaling pathway
mcc04144  Endocytosis
mcc04218  Cellular senescence
mcc04350  TGF-beta signaling pathway
mcc04380  Osteoclast differentiation
mcc04390  Hippo signaling pathway
mcc04520  Adherens junction
mcc04659  Th17 cell differentiation
mcc04926  Relaxin signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05142  Chagas disease
mcc05161  Hepatitis B
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05220  Chronic myeloid leukemia
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114675335
   04350 TGF-beta signaling pathway
    114675335
   04390 Hippo signaling pathway
    114675335
   04068 FoxO signaling pathway
    114675335
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114675335
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114675335
  09143 Cell growth and death
   04218 Cellular senescence
    114675335
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    114675335
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    114675335
  09152 Endocrine system
   04926 Relaxin signaling pathway
    114675335
  09158 Development and regeneration
   04380 Osteoclast differentiation
    114675335
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114675335
   05202 Transcriptional misregulation in cancer
    114675335
  09162 Cancer: specific types
   05210 Colorectal cancer
    114675335
   05212 Pancreatic cancer
    114675335
   05225 Hepatocellular carcinoma
    114675335
   05226 Gastric cancer
    114675335
   05220 Chronic myeloid leukemia
    114675335
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    114675335
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114675335
   05161 Hepatitis B
    114675335
  09174 Infectious disease: parasitic
   05142 Chagas disease
    114675335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    114675335
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     114675335
Protein kinases [BR:mcc01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   114675335
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 114675335
NCBI-ProteinID: XP_028698417
LinkDB
Position
2
AA seq 433 aa
YIPTTSNSFSPCFVSPSEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQ
QKLSSSWEAGKPRKLMDFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGR
FAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERK
TELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMP
IVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRM
NLENVEXFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGPRCGSTPCVESMKDNVLRD
RGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSE
EKIPEDGSLNTTK
NT seq 1302 nt   +upstreamnt  +downstreamnt
tacatacctaccacatccaactccttctctccttgttttgtttccccatcagaatacaac
accagcaatcctgacttgttgctagtcatatttcaagtgacaggcatcagcctcctgcca
ccactgggagttgccatatctgtcatcatcatcttctactgctaccgcgttaaccggcag
cagaagctgagctcatcctgggaagctggcaagccacggaagctcatggacttcagcgag
cactgtgccatcatcctggaagacgaccgctccgacatcagctccacatgcgccaacaac
atcaaccacaacacagagctgctgcccattgaactggacaccctggtggggaaaggtcgc
tttgctgaggtctataaggccaagctgaagcagaacacttcagagcagtttgagacagtg
gcagtcaagatctttccctatgaggagtatgcctcttggaagacggagaaggacatcttc
tcagacatcaacctgaagcatgagaacatactccagttcctgacagctgaggagcgcaag
acggagttggggaagcagtactggctgatcactgccttccatgccaagggcaacctacag
gagtacctgacgcggcatgtcatcagctgggaggacctgcgcaaactgggcagctccctc
gcccggggcattgcccacctccacagtgatcacactccgtgcgggaggcccaagatgccc
atcgtgcacagggacctcaagagctccaatatcctcgtgaagaacgacctgacctgctgc
ctgtgtgactttgggctttccctgcgtctggaccctactctgtctgtggatgacctggct
aacagcgggcaggtgggaactgcaagatacatggctccagaagtcctagaatccaggatg
aatttggagaatgtagagntctttaagcagaccgatgtctactccatggctctggtgctc
tgggaaatgacatcgcgctgtaatgcggtgggagaagtaaaagattatgagcctccattt
ggtccaaggtgcgggagcaccccctgtgtcgaaagcatgaaggacaacgtgttgagagat
cgaggacgaccagaaattcccagcttctggctcaaccaccagggcatccagatggtgtgt
gagacgttgactgagtgctgggaccacgacccagaggcccgcctcacagcccagtgtgtg
gcagaacgcttcagtgagctggagcacctggacaggctctcggggaggagctgctccgag
gagaagattcctgaagacggctccctaaacactaccaaatag

DBGET integrated database retrieval system