KEGG   Macaca mulatta (rhesus monkey): 114675515
Entry
114675515         CDS       T01028                                 

Definition
(RefSeq) bcl-2 homologous antagonist/killer-like
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01524  Platinum drug resistance
mcc04141  Protein processing in endoplasmic reticulum
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05160  Hepatitis C
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05203  Viral carcinogenesis
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114675515
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114675515
   04215 Apoptosis - multiple species
    114675515
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114675515
   05202 Transcriptional misregulation in cancer
    114675515
   05206 MicroRNAs in cancer
    114675515
   05203 Viral carcinogenesis
    114675515
  09162 Cancer: specific types
   05210 Colorectal cancer
    114675515
   05212 Pancreatic cancer
    114675515
   05225 Hepatocellular carcinoma
    114675515
   05226 Gastric cancer
    114675515
   05214 Glioma
    114675515
   05216 Thyroid cancer
    114675515
   05220 Chronic myeloid leukemia
    114675515
   05217 Basal cell carcinoma
    114675515
   05218 Melanoma
    114675515
   05213 Endometrial cancer
    114675515
   05224 Breast cancer
    114675515
   05222 Small cell lung cancer
    114675515
   05223 Non-small cell lung cancer
    114675515
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    114675515
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114675515
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    114675515
   05160 Hepatitis C
    114675515
   05164 Influenza A
    114675515
   05162 Measles
    114675515
   05168 Herpes simplex virus 1 infection
    114675515
   05163 Human cytomegalovirus infection
    114675515
   05167 Kaposi sarcoma-associated herpesvirus infection
    114675515
   05169 Epstein-Barr virus infection
    114675515
   05165 Human papillomavirus infection
    114675515
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    114675515
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    114675515
Transporters [BR:mcc02000]
 Other transporters
  Pores ion channels [TC:1]
   114675515
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 114675515
NCBI-ProteinID: XP_028698569
LinkDB
Position
14
AA seq 152 aa
MDTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLF
ESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVA
ALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 459 nt   +upstreamnt  +downstreamnt
atggacaccttgcccctgcaacctagcagcaccatggggcaggtgggacggcagctggcc
atcatcggggacgacatcaacagacgctatgactcagagttccagaccatgctgcagcac
ctgcagcccacggcagagaacgcctatgagtacttcaccaagattgcctccagcctgttt
gagagtggcatcaactggggccgtgtggtggctcttctgggcttcggctaccgtctggcc
ctacacgtctaccagcacggcctgactggcttcctgggccaggtgacccgcttcgtggtc
gacttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggca
gccctgaacttgggcaatggtcccatcctgaacgtgctggtggttctgggtgtggttctg
ttgggccagtttgtggtacgaagattcttcaaatcatga

KEGG   Macaca mulatta (rhesus monkey): 706534
Entry
706534            CDS       T01028                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01524  Platinum drug resistance
mcc04141  Protein processing in endoplasmic reticulum
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05160  Hepatitis C
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05203  Viral carcinogenesis
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    706534 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    706534 (BAK1)
   04215 Apoptosis - multiple species
    706534 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    706534 (BAK1)
   05202 Transcriptional misregulation in cancer
    706534 (BAK1)
   05206 MicroRNAs in cancer
    706534 (BAK1)
   05203 Viral carcinogenesis
    706534 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    706534 (BAK1)
   05212 Pancreatic cancer
    706534 (BAK1)
   05225 Hepatocellular carcinoma
    706534 (BAK1)
   05226 Gastric cancer
    706534 (BAK1)
   05214 Glioma
    706534 (BAK1)
   05216 Thyroid cancer
    706534 (BAK1)
   05220 Chronic myeloid leukemia
    706534 (BAK1)
   05217 Basal cell carcinoma
    706534 (BAK1)
   05218 Melanoma
    706534 (BAK1)
   05213 Endometrial cancer
    706534 (BAK1)
   05224 Breast cancer
    706534 (BAK1)
   05222 Small cell lung cancer
    706534 (BAK1)
   05223 Non-small cell lung cancer
    706534 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    706534 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    706534 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    706534 (BAK1)
   05160 Hepatitis C
    706534 (BAK1)
   05164 Influenza A
    706534 (BAK1)
   05162 Measles
    706534 (BAK1)
   05168 Herpes simplex virus 1 infection
    706534 (BAK1)
   05163 Human cytomegalovirus infection
    706534 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    706534 (BAK1)
   05169 Epstein-Barr virus infection
    706534 (BAK1)
   05165 Human papillomavirus infection
    706534 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    706534 (BAK1)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    706534 (BAK1)
Transporters [BR:mcc02000]
 Other transporters
  Pores ion channels [TC:1]
   706534 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 706534
NCBI-ProteinID: NP_001253660
Ensembl: ENSMMUG00000009104
UniProt: H9H3A9
LinkDB
Position
4
AA seq 211 aa
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEM
DTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcttcgggacaaggcccaggtcctcccaggcaggaatgcggagagcctgccctgccc
tctgcttctgaggagcaggtagcccgggacacagaggaggttttccgcagctacgttttt
taccgccatcagcaggaacaggaggctgaaggggcggctgcccctgccgacccagagatg
gacaccttgcccctgcaacctagcagcaccatggggcaggtgggacggcagctggccatc
atcggggacgacatcaacagacgctatgactcagagttccagaccatgctgcagcacctg
cagcccacggcagagaacgcctatgagtacttcaccaagattgcctccagcctgtttgag
agtggcatcaactggggccgtgtggtggctcttctgggcttcggctaccgtctggcccta
cacgtctaccagcacggcctgactggcttcctgggccaggtgacccgcttcgtggtcgac
ttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagcc
ctgaacttgggcaatggtcccatcctgaacgtgctggtggttctgggtgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system