KEGG   Macaca mulatta (rhesus monkey): 114675718
Entry
114675718         CDS       T01028                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha-like
  KO
K04737  interleukin 3 receptor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114675718
   04151 PI3K-Akt signaling pathway
    114675718
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114675718
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114675718
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    114675718
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114675718
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    114675718
   04090 CD molecules [BR:mcc04090]
    114675718
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL3 receptor family
   114675718
CD molecules [BR:mcc04090]
 Proteins
  114675718
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind CRAM_rpt
Other DBs
NCBI-GeneID: 114675718
NCBI-ProteinID: XP_028698699
LinkDB
Position
Unknown
AA seq 257 aa
MTLLWLTLLLVATPCLLQTKEDPNAPIRNLRMKEKAQQLMWDLNRNVTDVECIKGTDYSM
PAMNNSYCQFGAISLCEVTNYTVRVASPPFSTWILFPENSGTPQAGAENLTCWVHDVDFL
SCSWVVGPAAPADVQYDLYLNNPNSHEQYRCLHYTTDARGTQIGCRFDDIARLSRGSQSS
HILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFRYEL
RIQKRMQPVRTEQVSVA
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaccctcctttggctgacgctgctcctggtcgccacgccctgtctcctgcaaaccaag
gaggatccaaatgcaccaatcaggaatctaaggatgaaagaaaaggctcagcagttgatg
tgggacctgaacagaaacgtgaccgacgtggagtgtatcaaaggcaccgactattctatg
ccggcaatgaacaacagctattgccagttcggagccatttccttatgtgaagtgaccaac
tacaccgtccgagtggccagtcccccgttctccacgtggatcctcttccctgagaacagt
gggacgcctcaggcaggcgcggagaatctgacctgctgggttcatgacgtggatttcttg
agctgcagctgggtggtaggcccggcggcccccgctgacgtccagtacgacctgtacttg
aacaatcccaacagccacgaacagtacaggtgccttcactacacaacggatgctcgggga
acacagatcgggtgtcggttcgatgacatcgctcgactctcccgcggttctcaaagttcc
cacatcctggtgaggggcaggagcgcagccgtcagtatcccctgcacagataagtttgtc
ttcttttcacagattgagagattaactccacccaacatgactggagagtgtaatgagaca
cattccttcatgcactggaaaatgaaaagtcatttcaatcgcaaattccgctatgagctt
cggatccaaaagagaatgcagcctgtaaggacagaacaggtgagtgttgcgtag

DBGET integrated database retrieval system