KEGG   Macaca mulatta (rhesus monkey): 114675730
Entry
114675730         CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon omega-1-like
  KO
K05440  interferon omega
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04622  RIG-I-like receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114675730
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114675730
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    114675730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    114675730
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   114675730
SSDB
Motif
Pfam: Interferon CDT1_C
Other DBs
NCBI-GeneID: 114675730
NCBI-ProteinID: XP_028698706
LinkDB
Position
Unknown
AA seq 195 aa
MALLFPLLAALVMTSYSPVGSXGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFR
FPQEMVEGSQLQKAQVMSVLHEMLQQIFSLFHTERSSAAWNTTLLDHLHTGLHRQLEHLE
TCLVQVMREGESAGAIRSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTN
MQERLRSKDGDLGSS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccctcctcttccctctgctggcagccctagtgatgaccagctatagtcctgttgga
tctnctggctgtgatctgcctcagaaccatggcctacttagcaggaacaccttggtgctt
ctgcaccaaatgaggagaatctcccctttcttgtgtctcaaggacagaagagacttcagg
ttcccccaggagatggtagaagggagccagctgcagaaggcccaggtcatgtctgtcctc
catgagatgctacagcagatcttcagcctcttccacacagagcgctcctctgctgcctgg
aacacgaccctcctagaccatctccacactggacttcatcggcaactagaacacctggag
acctgcttggtgcaggtaatgcgagaaggagaatctgctggggcgattaggagccctgca
ctgaccttgaggaggtacttccagggaatccgtgtctacctgaaagagaagaaatacagc
gactgtgcctgggaagttgtcagaatggaaatcatgaaatccttgttcttatcaacaaac
atgcaagaaagactgagaagtaaagatggagacctggggtcatcttga

KEGG   Macaca mulatta (rhesus monkey): 711329
Entry
711329            CDS       T01028                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04622  RIG-I-like receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    711329
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    711329
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    711329
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    711329
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interferons
   711329
SSDB
Motif
Pfam: Interferon CDT1_C
Other DBs
NCBI-GeneID: 711329
NCBI-ProteinID: XP_001108113
LinkDB
Position
15
AA seq 220 aa
MSSENLGSNVKPYPAQQSQQHPHFPMALLFPLLAALVMTSYSPVGSLGCDLPQNHGLLSR
NTLVLLHQMRRISPFLCLKDRRDFRFPQEMVEGSQLQKAQVMSVLHEMLQQIFSLFHTER
SSAAWNTTLLDHLHTGLHRQLEHLETCLVQVMREGESAGAIRSPALTLRRYFQGIRVYLK
EKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDGDLGSS
NT seq 663 nt   +upstreamnt  +downstreamnt
atgtcttcagaaaacctagggtccaatgttaagccatatccagctcagcaaagccagcag
caccctcatttcccaatggccctcctcttccctctgctggcagccctagtgatgaccagt
tatagtcctgttggatctctgggctgtgatctgcctcagaaccatggcctacttagcagg
aacaccttggtgcttctgcaccaaatgaggagaatctcccctttcttgtgtctcaaggac
agaagagacttcaggttcccccaggagatggtagaagggagccagctgcagaaggcccag
gtcatgtctgtcctccatgagatgctacagcagatcttcagcctcttccacacagagcgc
tcctctgctgcctggaacacgaccctcctagaccatctccacactggacttcatcggcaa
ctagaacacctggagacctgcttggtgcaggtaatgcgagaaggagaatctgctggggcg
attaggagccctgcactgaccttgaggaggtacttccagggaatccgtgtctacctgaaa
gagaagaaatacagcgactgtgcctgggaagttgtcagaatggaaatcatgaaatccttg
ttcttatcaacaaacatgcaagaaagactgagaagtaaagatggagacctggggtcatct
tga

DBGET integrated database retrieval system