KEGG   Macaca mulatta (rhesus monkey): 114677751
Entry
114677751         CDS       T01028                                 

Gene name
PIM1
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase pim-1
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04630  JAK-STAT signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114677751 (PIM1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114677751 (PIM1)
   05206 MicroRNAs in cancer
    114677751 (PIM1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    114677751 (PIM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    114677751 (PIM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    114677751 (PIM1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114677751 (PIM1)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   114677751 (PIM1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal Choline_kinase APH Seadorna_VP7
Other DBs
NCBI-GeneID: 114677751
NCBI-ProteinID: XP_028703742
LinkDB
Position
4
AA seq 590 aa
MKFKRTKDASGVAGRSDEGCIPFPQERGSRLQFCSRPDSSTPSVTHVLRILRPRRAPQHT
NPQNPPPAYSATSARPSRLGGLGSESHRKTTLVGIPTHSPTPGAPASPPDTPTPVVSAQL
VMLRLEPLTQKPPRNREPQSRPRAAFDGFVIVWPCSPPWPPGEAPPRPRPPRPPRAPSPP
ARSSPLLLAAGRAGRLLQRPRWRRRPERSLWQRRRRRRRRRDPQQQQQQQPRASCPAALP
HKPHEPLTPPLSALPDPAGAPSRRQSRQRPQLSSDSPSAFRASRSHSRNATRSHSHSPRH
SHRHSPGSGSCCSSSGHRPCADILEVGMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEP
LESQYQXGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLL
KKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLE
AVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWI
RYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSGN
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgaagtttaaaaggacaaaggatgcaagtggagttgccggccggagcgacgagggctgc
atccctttcccgcaggagcggggctcccgcctccagttctgttccaggcctgactcctcc
actccctccgtgactcatgtcctgcggatccttcgcccccgacgcgccccccaacacaca
aacccccagaatccgcccccagcctacagcgcgacgtcagcccgccccagccgacttgga
ggtctcgggtctgagtcacacagaaagaccaccctcgtcggcatccccacacacagtccc
acacccggcgcgccagcctccccgcctgacacaccaacgcccgtcgtctccgcgcaactt
gttatgcttcggctcgagcccttgacccaaaaacctccgcgaaacagagagccgcagagc
cggcctcgggcggcctttgatggctttgttattgtttggccctgctccccgccttggcct
cccggagaggccccgccccgtccccgcccgccgcgccctccccgcgcgccctccccgccg
gcgcgctcctcccctttactcctggctgcggggcgagccgggcgtctgctgcagcggccg
cggtggcggaggaggcccgagaggagtctgtggcagcggcggcggcggcggcggcggcgg
cgggacccgcagcagcagcagcaacagcagccacgagcttcctgccccgcggcgctgccg
cacaagccccacgagccactcaccccgccgctctcagcgctgcccgaccccgctggcgcg
ccctcccgccgccagtcccggcagcgccctcagttgtcctccgactcgccctcggccttc
cgcgccagccgcagccacagccgcaacgccacccgcagccacagccacagccccaggcat
agtcatcggcacagccccggctccggctcctgctgcagctcctcggggcaccgtccctgc
gccgacatcctggaggttgggatgctcttatccaaaatcaactcgcttgcccacctgcgc
gccgcgccctgcaacgacctgcacgccaccaagctggcgcccggcaaggagaaggagccc
ctggagtcgcagtaccagngtgggcccctattgggcagcggcggcttcggctcggtctac
tcaggcatccgcgtctccgacaacttgccggtggccatcaaacacgtggagaaggaccgg
atttccgactggggagagctgcccaatggcacccgagtgcccatggaagtggtcctgctg
aagaaggtgagctcgggcttctccggcgtcattaggctcctggactggttcgagaggccc
gacagttttgtcctgatcctggagagacccgagccggtgcaagatctcttcgacttcatc
acagaaaggggggccctgcaagaggagctggcccgcagcttcttctggcaggtgctggag
gccgtgcgacactgccacaactgcggggtgctccaccgcgacatcaaggacgaaaacatc
ctcatcgacctcaatcgcggcgagctcaagctcatcgacttcgggtcgggggcgctgctc
aaggacaccgtctacacggatttcgatgggacccgagtgtatagccctccagagtggatc
cgctaccatcgctaccatggcaggtcggcggcagtttggtccctggggatcctgttgtat
gatatggtgtgtggagatattcctttcgagcatgatgaagagatcatcaggggccaagtt
ttcttcaggcagagggtctcttcaggtaactga

KEGG   Macaca mulatta (rhesus monkey): 719232
Entry
719232            CDS       T01028                                 

Definition
(RefSeq) serine/threonine-protein kinase pim-1
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04630  JAK-STAT signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    719232
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    719232
   05206 MicroRNAs in cancer
    719232
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    719232
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    719232
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    719232
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     719232
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   719232
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH Choline_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 719232
NCBI-ProteinID: XP_014991745
UniProt: H9YX84
LinkDB
Position
4
AA seq 313 aa
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
NT seq 942 nt   +upstreamnt  +downstreamnt
atgctcttgtccaaaatcaactcgcttgcccacctgcgcgccgcgccctgcaacgacctg
cacgccaccaagctggcgcccggcaaggagaaggagcccctggagtcgcagtaccaggtg
ggcccgctattgggcagcggcggcttcggctcggtctactcaggcatccgcgtctccgac
aacttgccggtggccatcaaacacgtggagaaggaccggatttccgactggggagagctg
cccaatggcacccgagtgcccatggaagtggtcctgctgaagaaggtgagctcgggcttc
tccggcgtcattaggctcctggactggttcgagaggcccgacagttttgtcctgatcctg
gagagacccgagccggtgcaagatctcttcgacttcatcacggaaaggggggccctgcaa
gaggagctggcccgcagcttcttctggcaggtgctggaggccgtgcgacactgccacaac
tgcggggtgctccaccgcgacatcaaggacgaaaacatcctcatcgacctcaatcgcggc
gagctcaagctcatcgacttcgggtcgggggcgctgctcaaggacaccgtctacacggat
ttcgatgggacccgagtgtatagccctccagagtggatccgctaccatcgctaccatggc
aggtcggcggcagtttggtccctggggatcctgttgtatgatatggtgtgtggagatatt
cctttcgagcatgacgaagagatcatcaggggccaagttttcttcaggcagagggtctct
tcagagtgtcagcatctcattagatggtgcttggccctgagaccatcagataggccaacc
ttcgaagaaatccagaaccatccatggatgcaagatgttctcctgccccaagaaactgct
gagatccacctccacagcctgtcaccagggcccagcaaatag

DBGET integrated database retrieval system