KEGG   Macaca mulatta (rhesus monkey): 574097Help
Entry
574097            CDS       T01028                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04068  FoxO signaling pathway
mcc04146  Peroxisome
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    574097 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    574097 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    574097 (SOD2)
   04213 Longevity regulating pathway - multiple species
    574097 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    574097 (SOD2)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     574097 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 574097
NCBI-ProteinID: NP_001027977
Ensembl: ENSMMUG00000038719
UniProt: H9EUV0
LinkDB All DBs
Position
4
AA seq 222 aa AA seqDB search
MLSRAVCGTGRQLAPALGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFEKFKEKLTAASVGVQGSGWGWLGFNKERGQLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgagccgggcagtttgcggcaccggcaggcagttggcgccggctttggggtatctg
ggctccaggcagaaacacagcctccccgacctgccctacgactacggcgccctggagcct
cacatcaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctgaacgttaccgaggagaagtaccaggaggcgttggccaagggagatgttacagcc
cagatagctcttcagcctgcactgaagttcaatggtggtggtcatatcaatcatagcatt
ttctggacaaacctcagccctaatggtggtggagaacccaaaggggagttgctggaagcc
atcaaacgtgactttggttcctttgaaaagtttaaggagaagctgacggctgcatctgtt
ggtgtccaaggctcaggttggggttggcttggttttaataaggaacggggacagttacaa
attgctgcttgtccgaatcaggatccactgcaaggaacaacaggccttattccactgctg
gggattgatgtgtgggagcacgcttattaccttcagtataaaaatgtcaggcctgattac
ctaaaagctatttggaatgtaatcaactgggagaatgtaactgaaagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system