KEGG   Macaca mulatta (rhesus monkey): 574159
Entry
574159            CDS       T01028                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01524  Platinum drug resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04068  FoxO signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04217  Necroptosis
mcc04650  Natural killer cell mediated cytotoxicity
mcc04722  Neurotrophin signaling pathway
mcc04932  Non-alcoholic fatty liver disease
mcc04940  Type I diabetes mellitus
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    574159 (FASLG)
   04014 Ras signaling pathway
    574159 (FASLG)
   04068 FoxO signaling pathway
    574159 (FASLG)
   04151 PI3K-Akt signaling pathway
    574159 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574159 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    574159 (FASLG)
   04217 Necroptosis
    574159 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    574159 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    574159 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574159 (FASLG)
   05205 Proteoglycans in cancer
    574159 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    574159 (FASLG)
   05330 Allograft rejection
    574159 (FASLG)
   05332 Graft-versus-host disease
    574159 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    574159 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    574159 (FASLG)
   04932 Non-alcoholic fatty liver disease
    574159 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    574159 (FASLG)
   05161 Hepatitis B
    574159 (FASLG)
   05160 Hepatitis C
    574159 (FASLG)
   05164 Influenza A
    574159 (FASLG)
   05162 Measles
    574159 (FASLG)
   05168 Herpes simplex virus 1 infection
    574159 (FASLG)
   05163 Human cytomegalovirus infection
    574159 (FASLG)
   05165 Human papillomavirus infection
    574159 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    574159 (FASLG)
   05143 African trypanosomiasis
    574159 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    574159 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    574159 (FASLG)
   04052 Cytokines and growth factors [BR:mcc04052]
    574159 (FASLG)
   04090 CD molecules [BR:mcc04090]
    574159 (FASLG)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   574159 (FASLG)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Tumor necrosis fators
   574159 (FASLG)
CD molecules [BR:mcc04090]
 Proteins
  574159 (FASLG)
SSDB
Motif
Pfam: TNF GutM
Other DBs
NCBI-GeneID: 574159
NCBI-ProteinID: NP_001028010
Ensembl: ENSMMUG00000007285
UniProt: P63307
LinkDB
Position
1
AA seq 280 aa
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP
PLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQK
HTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGL
VINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWAH
SSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
NT seq 843 nt   +upstreamnt  +downstreamnt
atgcagcagcccttcaattacccatatccccagatctactgggtggacagcagtgccagc
tctccctgggcccctccaggcacagttcttccctgtccaacctctgtgcccagaaggcct
ggtcaaaggaggccaccaccaccgccgccgccgccgccactaccacctccaccgccacca
ccactgcctccactaccgctgccacccttgaagaagaggggaaaccacagcacaggcctt
tgtctccttgtgatgtttttcatggttctggttgccttggtaggattgggactggggatg
tttcagctcttccacttacagaaagagctggcagaactccgagagtctaccagccagaag
catacagcatcatctttggagaagcaaataggtcaccccagtccaccccctgagaaaaag
gagcagaggaaagtggcccatttaacaggcaagcccaactcaaggtccatgcctctggaa
tgggaagacacctatggaattgtcctgctttctggagtgaaatataagaagggtggcctt
gtgatcaatgaaactgggctgtactttgtatattccaaagtatacttccggggtcaatct
tgcaccaacctgcccctgagccacaaggtctacatgaggaactctaagtatccccaggat
ctggtgatgatggaggggaagatgatgagctactgcactactgggcagatgtgggcccac
agcagctacctgggggcagtgttcaatcttaccagtgctgatcatttatatgtcaatgta
tctgagctctctctggtcaattttgaggaatctcagacattttttggcctatataagctc
taa

DBGET integrated database retrieval system