KEGG   Macaca mulatta (rhesus monkey): 574209
Entry
574209            CDS       T01028                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A isoform 1 precursor
  KO
K05448  vascular endothelial growth factor A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04370  VEGF signaling pathway
mcc04510  Focal adhesion
mcc04926  Relaxin signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05219  Bladder cancer
mcc05323  Rheumatoid arthritis
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    574209 (VEGFA)
   04014 Ras signaling pathway
    574209 (VEGFA)
   04015 Rap1 signaling pathway
    574209 (VEGFA)
   04370 VEGF signaling pathway
    574209 (VEGFA)
   04066 HIF-1 signaling pathway
    574209 (VEGFA)
   04020 Calcium signaling pathway
    574209 (VEGFA)
   04151 PI3K-Akt signaling pathway
    574209 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    574209 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    574209 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574209 (VEGFA)
   05206 MicroRNAs in cancer
    574209 (VEGFA)
   05205 Proteoglycans in cancer
    574209 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    574209 (VEGFA)
   05211 Renal cell carcinoma
    574209 (VEGFA)
   05219 Bladder cancer
    574209 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    574209 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    574209 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    574209 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    574209 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    574209 (VEGFA)
   05165 Human papillomavirus infection
    574209 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    574209 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    574209 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    574209 (VEGFA)
Cytokines and growth factors [BR:mcc04052]
 Growth factors
  Growth factors (RTK binding)
   574209 (VEGFA)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   574209 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 574209
NCBI-ProteinID: NP_001265313
Ensembl: ENSMMUG00000004577
UniProt: I2CY18
LinkDB
Position
4
AA seq 215 aa
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQ
DPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcattggagccttgccttgctgctgtacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggaggagggcagaatcatcacgaagtg
gtgaagttcatggatgtctatcagcgcagctactgccatccaatcgagaccctggtggac
atcttccaggagtaccctgatgagattgagtacatcttcaagccatcctgtgtgcccctg
atgcgatgtgggggctgctgcaatgacgagggcctggagtgtgtgcccactgaggagtcc
aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat
aagtcctggagcgttccctgtgggccttgctcagagcggagaaagcatttgtttgtacaa
gatccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcag
cttgagttaaacgaacgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system