KEGG   Macaca mulatta (rhesus monkey): 574214
Entry
574214            CDS       T01028                                 

Gene name
FYN
Definition
(RefSeq) tyrosine-protein kinase Fyn isoform X1
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04360  Axon guidance
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04611  Platelet activation
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04725  Cholinergic synapse
mcc05020  Prion disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    574214 (FYN)
   04071 Sphingolipid signaling pathway
    574214 (FYN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    574214 (FYN)
   04520 Adherens junction
    574214 (FYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    574214 (FYN)
   04650 Natural killer cell mediated cytotoxicity
    574214 (FYN)
   04660 T cell receptor signaling pathway
    574214 (FYN)
   04664 Fc epsilon RI signaling pathway
    574214 (FYN)
  09156 Nervous system
   04725 Cholinergic synapse
    574214 (FYN)
  09158 Development and regeneration
   04360 Axon guidance
    574214 (FYN)
   04380 Osteoclast differentiation
    574214 (FYN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    574214 (FYN)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    574214 (FYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    574214 (FYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    574214 (FYN)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     574214 (FYN)
Protein kinases [BR:mcc01001]
 Non-receptor tyrosine kinases
  SRC family
   574214 (FYN)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    574214 (FYN)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    574214 (FYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3 zf-RING_14
Other DBs
NCBI-GeneID: 574214
NCBI-ProteinID: XP_014993051
Ensembl: ENSMMUG00000017017
UniProt: F7FVL2 A0A663DJ18
LinkDB
Position
4
AA seq 537 aa
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcaacaaaactgacggaggagagggacggc
agcctgaaccagagctccgggtaccgctatggcacagaccccacccctcagcactacccc
agcttcggtgtgacctccatccccaactacaacaacttccacgcagccgggggccaagga
ctcactgtctttggaggtgtgaactcttcgtctcatacggggaccttgcgtacgagagga
ggaacaggagtgacactgtttgtggccctttatgactatgaagcacggacagaagatgac
ctgagttttcacaaaggagaaaaatttcaaatattgaacagctcggaaggagattggtgg
gaagcccgctccttgacaactggagagacaggttacattcccagcaattatgtggctcca
gttgactctatccaggcagaagagtggtactttggaaaacttggccgaaaagatgctgag
cgacagctattgtcctttggaaacccaagaggtacctttcttatccgcgagagtgaaacc
accaaaggtgcctattcactttccatccgcgattgggatgatatgaaaggagaccacgtc
aaacattataaaattcgcaaacttgacaacggtggatactacattaccacccgggcccag
tttgaaacccttcagcagcttgtacaacattactcagagagagctgcaggtctctgctgc
cgcctagtagttccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaacacaaaagtagccataaagact
ctcaaaccaggcacaatgtcccccgaatcattccttgaggaagcgcagatcatgaagaag
ctgaagcacgacaagctggtccagctctacgcagtggtgtctgaggagcccatctacatc
gtcaccgagtatatgaataaaggaagtttactggatttcttaaaagatggagaaggaaga
gctctgaaattaccaaatcttgtggacatggcagcacaggtggctgcaggaatggcttac
atcgagcgcatgaattatatccatagagatctgcgatcagcaaacattctagtggggaat
ggactcatatgcaagattgctgatttcggattggcccgattgatcgaagacaatgagtac
acagcaagacaaggtgcaaaattccccatcaagtggacggcccccgaggcagccctgtac
gggaggttcacaatcaagtctgacgtgtggtcttttggaatcttactcacagagctggtc
accaaaggaagagtgccatacccaggcatgaacaaccgggaggtgctggagcaggtggag
cgaggctacaggatgccctgcccgcaggactgccccatctctctgcatgagctcatgatc
cactgctggaaaaaggaccctgaagaacgccctacttttgagtacttgcagagcttcctg
gaagactactttaccgccacagagccccagtaccaacctggtgaaaacctgtaa

DBGET integrated database retrieval system