KEGG   Macaca mulatta (rhesus monkey): 574243
Entry
574243            CDS       T01028                                 

Gene name
CXCL10
Definition
(RefSeq) C-X-C motif chemokine 10 precursor
  KO
K12671  C-X-C motif chemokine 10
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04062  Chemokine signaling pathway
mcc04620  Toll-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04657  IL-17 signaling pathway
mcc04668  TNF signaling pathway
mcc05160  Hepatitis C
mcc05164  Influenza A
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    574243 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574243 (CXCL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    574243 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    574243 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    574243 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    574243 (CXCL10)
   04657 IL-17 signaling pathway
    574243 (CXCL10)
   04062 Chemokine signaling pathway
    574243 (CXCL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    574243 (CXCL10)
   05171 Coronavirus disease - COVID-19
    574243 (CXCL10)
   05164 Influenza A
    574243 (CXCL10)
   05169 Epstein-Barr virus infection
    574243 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    574243 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    574243 (CXCL10)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Chemokines
   574243 (CXCL10)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Chemokines
   574243 (CXCL10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 574243
NCBI-ProteinID: NP_001028064
Ensembl: ENSMMUG00000020903
UniProt: Q8MIZ1
LinkDB
Position
5
AA seq 98 aa
MNQTAILICCLVFLTLSGIQGIPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHV
EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaatcaaactgccattctgatttgctgccttgtctttctgactctaagtggtattcaa
ggaatacctctctcaagaactgtacgctgtacctgcatcagcattagtaatcaacctgtt
aatccaaggtctttagaaaaacttgaaattattcctccaagtcaattttgtccacatgtt
gagatcattgctacaatgaaaaagaagggtgagaagaggtgtctgaatccagaatctaag
gccatcaagaatttactgaaagcagttagcaaggaaaggtctaaaagatctccttaa

DBGET integrated database retrieval system