KEGG   Macaca mulatta (rhesus monkey): 574265
Entry
574265            CDS       T01028                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04310  Wnt signaling pathway
mcc04390  Hippo signaling pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04670  Leukocyte transendothelial migration
mcc04916  Melanogenesis
mcc04919  Thyroid hormone signaling pathway
mcc04934  Cushing syndrome
mcc05010  Alzheimer disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05100  Bacterial invasion of epithelial cells
mcc05132  Salmonella infection
mcc05160  Hepatitis C
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05210  Colorectal cancer
mcc05213  Endometrial cancer
mcc05215  Prostate cancer
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    574265 (CTNNB1)
   04310 Wnt signaling pathway
    574265 (CTNNB1)
   04390 Hippo signaling pathway
    574265 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    574265 (CTNNB1)
   04520 Adherens junction
    574265 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    574265 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    574265 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    574265 (CTNNB1)
   04916 Melanogenesis
    574265 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574265 (CTNNB1)
   05205 Proteoglycans in cancer
    574265 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    574265 (CTNNB1)
   05225 Hepatocellular carcinoma
    574265 (CTNNB1)
   05226 Gastric cancer
    574265 (CTNNB1)
   05216 Thyroid cancer
    574265 (CTNNB1)
   05217 Basal cell carcinoma
    574265 (CTNNB1)
   05215 Prostate cancer
    574265 (CTNNB1)
   05213 Endometrial cancer
    574265 (CTNNB1)
   05224 Breast cancer
    574265 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    574265 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    574265 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    574265 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    574265 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    574265 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    574265 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    574265 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    574265 (CTNNB1)
   05163 Human cytomegalovirus infection
    574265 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    574265 (CTNNB1)
   05165 Human papillomavirus infection
    574265 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 574265
NCBI-ProteinID: NP_001244847
Ensembl: ENSMMUG00000014627
UniProt: F7GNE4
LinkDB
Position
2
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctactcaagctgatttgatggagttggacatggccatggaaccagacagaaaagcg
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggatacctcc
caagtcctgtatgagtgggaacagggattttctcagtccttcactcaagaacaagtagct
gatattgatggacagtatgcaatgactcgagctcagagggtacgagctgctatgttccct
gagacattagatgagggcatgcagatcccatctacacagtttgatgctgctcatcccact
aatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaacttgatt
aactatcaagatgatgcagaacttgccacacgtgcaattcctgaactgacaaaactgcta
aatgatgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgctatcatgcgttctcctcagatggtgtctgctattgtacgt
accatgcagaatacaaatgatgtagaaacagctcgttgtaccgctgggaccttgcataac
ctttcccatcatcgggagggcttgttggccatctttaagtctggaggcattcctgccctg
gtgaaaatgcttggttcaccagtggattctgtgttgttttatgccattacaactctccac
aaccttttattacatcaagaaggagctaaaatggcagtgcgtttagctggcgggctacag
aaaatggttgccttgctcaacaaaacaaacgttaaattcttggctattacgacagactgc
cttcaaattttagcatatggcaaccaagaaagcaagctgatcatactggctagtggtgga
ccccaagctttagtaaatataatgaggacctatacttatgagaaactactgtggaccaca
agcagagtgctgaaggtgctatccgtctgctctagtaataagccagctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcaacgtcttgttcagaac
tgtctttggactctcaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
ctccttgggactcttgttcagcttctgggttcagatgatataaatgtggtcacctgtgca
gctggaattctttctaacctcacttgcaataattataagaataagatgatggtctgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgggctggtgacagggaagacatc
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaagaagcagagatg
gcccagaatgcagttcgccttcactatggactaccagttgtggttaagctcttacaccca
ccatcccactggcctctgataaaggctactgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgcacctttgcgtgagcagggtgccattccacgactagttcagttgctt
gttcgtgcacatcaggatacccagcgccgtacgtccatgggtgggacacagcagcaattt
gtggagggggtccgcatggaagaaatagttgaaggttgtactggagcccttcacatccta
gctcgggatgttcacaaccgaattgtaatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaacatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagcgattgaagctgagggagccacagctcctctg
acagagttacttcactctaggaatgaaggtgtggcgacgtatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaagattacaagaaacggctttcagttgagctgaccagc
tctctcttcagaacggagccaatggcttggaatgagactgcggatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgatcctagctatcgttcttttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggaacatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctgggacatgcccag
gacctcatggatgggctgcctccaggtgatagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system