KEGG   Macaca mulatta (rhesus monkey): 574275
Entry
574275            CDS       T01028                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04510  Focal adhesion
mcc04650  Natural killer cell mediated cytotoxicity
mcc04722  Neurotrophin signaling pathway
mcc04910  Insulin signaling pathway
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
mcc05034  Alcoholism
mcc05100  Bacterial invasion of epithelial cells
mcc05214  Glioma
mcc05220  Chronic myeloid leukemia
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    574275 (SHC3)
   04014 Ras signaling pathway
    574275 (SHC3)
   04072 Phospholipase D signaling pathway
    574275 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    574275 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    574275 (SHC3)
   04062 Chemokine signaling pathway
    574275 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    574275 (SHC3)
   04915 Estrogen signaling pathway
    574275 (SHC3)
   04917 Prolactin signaling pathway
    574275 (SHC3)
   04926 Relaxin signaling pathway
    574275 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    574275 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    574275 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    574275 (SHC3)
   05226 Gastric cancer
    574275 (SHC3)
   05214 Glioma
    574275 (SHC3)
   05220 Chronic myeloid leukemia
    574275 (SHC3)
   05224 Breast cancer
    574275 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    574275 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    574275 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    574275 (SHC3)
   01522 Endocrine resistance
    574275 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 574275
NCBI-ProteinID: NP_001252619
UniProt: F6W915
LinkDB
Position
15
AA seq 598 aa
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARATPAAAPYLVSGEALRKAPDDG
PGSLGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGSAPPAPRAPA
MSTARKGRPGDEPLPRPPRGAPHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQI
TREAISRVCEAVPGAKGAFKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPD
SKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGEGSDHPYYNSIPSKMPPPGGFLDARL
KPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQAPFRQNERQGSLDIYSMPEGKLHVA
PTGEAPTYVNTQQIPPQAWPTVVSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVE
CISPVSPRAPDAKMLEDLQAETWYQGEMSRKEAEGLLEKDGDFLVRKSTTNPGSFVLTGM
HNGQAKHLLLVDPEGTIRTKDRVFDSISHLINHHLESSLPIVSAGSELCLQQPVERKQ
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgcttcaggaatgactcggtgacatcggtcgatgac
cttctccacagcctgtcggtgagcggcggcggaggcaaggtttcagcggcgcgcgcgacc
ccggcggcggctccctacttggtgtccggagaggcgctgcgcaaggcgcccgacgatggg
cccggcagcctgggccacctgctccacaaggtgtcccacctgaaactctccagctcgggc
ctccgcggcctgtcgtcggccgcccgggagcgggcgggcgcgcggctctcgggcagctgc
agcgcgcccagcctggccgccccggacggcagcgcgcccccggcgccccgcgccccggcc
atgagcaccgccaggaagggccggccgggcgacgagccgctgcccagaccccctcggggg
gcgccgcacgccagcgaccaggtgctggggcctggagtcacctacgtggtcaagtacttg
gggtgcattgaagttctgcgctcaatgaggtctcttgacttcagtacaagaacacaaatt
accagggaagccatcagccgtgtctgtgaagctgtccctggtgccaagggagccttcaag
aagagaaagcctccgagcaaaatgctgtccagcatcttgggaaagagcaacctccagttt
gcgggaatgagcatctctctgaccatctccacggccagtctgaacctgcgaactccggac
tccaaacagatcatagcgaatcaccacatgcggtccatctccttcgcctctgggggagac
ccggacacaactgactatgttgcatatgtggctaaggaccctgttaatcgcagagcttgt
cacattttggaatgctgtgatgggctggcccaggatgtcatcggctccataggacaagcc
tttgagctccggtttaagcaatatttacagtgtcctaccaagattcccgctctccatgat
cgaatgcagagtctggatgagccatggacagaagaggagggagaaggctcagaccacccg
tactacaacagcatcccaagcaagatgcctcctccagggggctttcttgatgctcgactg
aaacccagaccccatgctcctgacactgcacagtttgcaggaaaagagcagacttattac
cagggaagacacttaggagacacctttggtgaagactggcagcaagcacctttcaggcaa
aatgagagacaagggtccttggacatctacagcatgccagaagggaaactgcacgtggcc
cccacaggagaagcacccacctacgtcaacacccagcagatcccaccgcaggcctggccg
actgtggtcagcagcgctgagagcagcccgaggaaagacctctttgacatgaaacctttt
gaagatgctctcaagaaccagcccttggggcccgtgttaagcaaggcagcctccgtggag
tgcatcagccctgtgtcacccagagccccggatgccaagatgctggaggacctgcaagct
gagacttggtaccaaggagagatgagcaggaaggaggcagaggggctgctggagaaagac
ggagacttcctggtcaggaagagcaccaccaacccgggctcctttgtcctcacgggcatg
cacaatggccaggccaagcacctgctgctcgtggacccggaaggcacgatccggacgaag
gacagagtctttgacagtatcagccacctcatcaaccaccacttagagagcagcctgccc
atcgtctctgcggggagtgagctgtgcctccagcagccagtggagaggaagcagtga

KEGG   Macaca mulatta (rhesus monkey): 714611
Entry
714611            CDS       T01028                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04510  Focal adhesion
mcc04650  Natural killer cell mediated cytotoxicity
mcc04722  Neurotrophin signaling pathway
mcc04910  Insulin signaling pathway
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
mcc05034  Alcoholism
mcc05100  Bacterial invasion of epithelial cells
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05220  Chronic myeloid leukemia
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    714611 (SHC4)
   04014 Ras signaling pathway
    714611 (SHC4)
   04072 Phospholipase D signaling pathway
    714611 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    714611 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    714611 (SHC4)
   04062 Chemokine signaling pathway
    714611 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    714611 (SHC4)
   04915 Estrogen signaling pathway
    714611 (SHC4)
   04917 Prolactin signaling pathway
    714611 (SHC4)
   04926 Relaxin signaling pathway
    714611 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    714611 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    714611 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    714611 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    714611 (SHC4)
   05226 Gastric cancer
    714611 (SHC4)
   05214 Glioma
    714611 (SHC4)
   05220 Chronic myeloid leukemia
    714611 (SHC4)
   05224 Breast cancer
    714611 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    714611 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    714611 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    714611 (SHC4)
   01522 Endocrine resistance
    714611 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 714611
NCBI-ProteinID: XP_001113330
Ensembl: ENSMMUG00000009833
UniProt: G7MX95 A0A1D5R2Z0
LinkDB
Position
7
AA seq 630 aa
MRERSQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGNKGSPQPPH
PALAPHLPAEDAALPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESRDPGSSSPSSPETSLSRSGTAPPPQPDLVSHRATALTPDSCPLPGPGEPPLRSRQDRH
FLQHLLGMGMNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECHNGMAQDVINTIGQAFELRFKQYLKNPSLDTSCESEEV
RIDSHAEESEDHEYYNEIPGKQPPAGGVSDMRIKVQATEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRAIGNVHPRGVQSQRDTSLLKHTCRVDLFDDPCYINTQALQSTLGSAGN
QSSAQPLGSPWHCGKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPALLHSNK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgagaacgcagccaggacagcctggcaggactcgtgctgtatgtaggactcttcggg
caccccgggatgctgcacagggccaagtacagccgctttcggaacgagtcgatcacgtcc
ttggacgaaggtagctccggaggctcggtcgggaacaagggctcaccgcagcctccccac
cccgccctggcacctcacctgccggctgaagatgccgccttgccgtcgcaggagagcccc
accccactgtgcaccttgatcccccgcatggcgagcatgaagctggccaacccggccacg
ttgctgagtctgaaaaacttttgcctgggtaccaaagaggtgcctcggctgaagctccag
gaaagccgggacccaggttccagcagtccctcttccccagaaaccagtctaagtaggtct
gggactgcacctccaccgcagccggacctggtgagccacagggcaaccgccctaacccct
gattcgtgcccgcttcctggccctggggagccaccccttaggagcaggcaggacaggcac
tttctgcagcacctgttggggatgggcatgaactactgtgtgaggtacatgggctgcatt
gaagtgctgcaatcaatgaggtcactggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccccggggcaaatggagccattaaaaagcgaaag
cctccagttaagttcctatcaacagttcttggcaaaagtaatcttcagttttcaggaatg
aatataaaactgaccatctcaacatgcagtctcacactgatgaatcttgacaaccaacag
attattgcaaatcatcatatgcagtctatttcgtttgcctctggaggggatcctgatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgtcacatattg
gaatgccacaatggaatggcccaagacgtcataaataccatagggcaggcttttgaactc
cggtttaaacagtacttgaaaaatccttctttagatacgtcttgtgaaagtgaggaggtg
cgtattgatagccatgccgaggagagcgaagatcatgaatattacaatgaaattccaggg
aagcagccaccagccggtggtgtttccgatatgcggatcaaagttcaagccacggaacaa
atggcttactgccccatacggtgtgaaaagttgtgctatttgcctggaaactccaagtgc
agcagtgtatatgagaactgtttagaacaaagcagggcaataggtaatgtccatccaaga
ggggtgcagtcccagcgagatacctcattattgaagcacacgtgccgagtagatctcttt
gatgacccctgctacattaatacacaggctcttcaaagtacacttggctctgctggaaat
caaagctcagcccaaccactggggagcccttggcactgcggaaaggcaccagaaactgtt
cagccgggtgccacagcccagcctgccagctcacattctttgccacacattaagcagcag
ctgtggagtgaagaatgctatcatggcaagctgagcaggaaggcggcagagagcctcttg
gtaaaggatggggactttttggttcgagagagtgcaacctcccccggccaatatgtgctg
agtggactacagggaggccaagcaaaacatcttcttctggtggatcctgaaggcaaggtg
aggaccaaggatcatgtatttgataacgtcggccaccttatcagataccatatggataac
agtttgccaatcatctcttctggaagtgaagtaagccttaaacaaccagtgagaaaagat
aataatccagcacttttgcattccaacaaatga

KEGG   Macaca mulatta (rhesus monkey): 718982
Entry
718982            CDS       T01028                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1
  KO
K06279  SHC-transforming protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04510  Focal adhesion
mcc04650  Natural killer cell mediated cytotoxicity
mcc04722  Neurotrophin signaling pathway
mcc04910  Insulin signaling pathway
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
mcc05034  Alcoholism
mcc05100  Bacterial invasion of epithelial cells
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05220  Chronic myeloid leukemia
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    718982 (SHC1)
   04014 Ras signaling pathway
    718982 (SHC1)
   04072 Phospholipase D signaling pathway
    718982 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    718982 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    718982 (SHC1)
   04062 Chemokine signaling pathway
    718982 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    718982 (SHC1)
   04915 Estrogen signaling pathway
    718982 (SHC1)
   04917 Prolactin signaling pathway
    718982 (SHC1)
   04926 Relaxin signaling pathway
    718982 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    718982 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    718982 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    718982 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    718982 (SHC1)
   05226 Gastric cancer
    718982 (SHC1)
   05214 Glioma
    718982 (SHC1)
   05220 Chronic myeloid leukemia
    718982 (SHC1)
   05224 Breast cancer
    718982 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    718982 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    718982 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    718982 (SHC1)
   01522 Endocrine resistance
    718982 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 718982
NCBI-ProteinID: NP_001248416
Ensembl: ENSMMUG00000006581
UniProt: I2CUU8
LinkDB
Position
1
AA seq 584 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGAARSTAPSAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPAGR
ELFDDPSYVNVQNLDKVRQAVGGAGLPNPAVNGSAPRDLFDMKPFEDALRVPPPPQSVSM
AEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaatccactccggaatgagtctctgtcatcg
ctggaggagggggcttcagggtccacccccccggaggagctgccttccccatcagcttca
tccctggggcccatcctgcctcctctgcctggggacgatagtcccactactctgtgctcc
ttcttcccccggatgagcaacctgaggctggccaacccggctggggggcgcccagggtct
aagggggagccaggaagggcagccgatgatggggaggggatcgtaggggcagccatgcca
gactcaggccccctacccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacgcggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tcctacttggttcggtacatgggctgtgtggaggtccttcagtcaatgcgtgccctggac
ttcaacacccggactcaggttaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgctaagggggcgacaaggaggagaaagccctgtagccgcccgctcagctctatcctg
gggaggagtaacctgaaatttgctggaatgccaatcactctcaccgtctccaccagcagc
ctcaacctcatggccgcagactgcaaacagatcatcgccaaccaccacatgcaatctatc
tcatttgcatccggcggggatccggacacagccgagtatgtcgcctacgttgccaaagac
cctgtgaatcagagagcctgccacattctggagtgtcccgaagggcttgcccaggatgtc
atcagcaccattggccaggcctttgagttgcgcttcaaacaatacctcaggaacccaccc
aaactggtcacccctcatgacaggatggctggctttgatggctcagcgtgggatgaggag
gaggaagagccacctgaccatcagtactataatgacttcccggggaaggaaccccccctg
gggggggtggtagacatgaggcttcgggaaggagctgctccaggggctgctcgatccact
gcacccagtgcccagacccctagccacttgggagctacactgcctgtaggacagcctgtt
gggggagatccagaagtccgaaaacagatgccacctccaccaccctgtccagcaggcaga
gagctctttgacgatccctcctatgtcaacgtccagaacctagacaaggtccggcaagca
gtgggtggtgctgggctccccaatcctgctgtcaatggcagtgcaccccgtgacctgttt
gatatgaagccctttgaagatgctcttcgggtgcctccacctccccagtcagtgtccatg
gctgagcagctccgaggggagccctggttccatgggaagctgagtcggcgggaggctgag
gcactgctgcagctcaacggggacttcctggtgcgggagagcacgaccacacctggccag
tatgtgctcactggcttgcagagtgggcagcccaagcatctgctactggtggaccctgag
ggtgtggttcggactaaggatcaccgctttgagagtgtcagtcacctcatcagctaccat
atggacaatcacttgcccatcatctctgcgggcagcgaactgtgtctacagcaacctgtg
gagcggaaactgtga

KEGG   Macaca mulatta (rhesus monkey): 721021
Entry
721021            CDS       T01028                                 

Gene name
SHC2
Definition
(RefSeq) SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04370  VEGF signaling pathway
mcc04510  Focal adhesion
mcc04650  Natural killer cell mediated cytotoxicity
mcc04722  Neurotrophin signaling pathway
mcc04910  Insulin signaling pathway
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
mcc05034  Alcoholism
mcc05100  Bacterial invasion of epithelial cells
mcc05214  Glioma
mcc05220  Chronic myeloid leukemia
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    721021 (SHC2)
   04014 Ras signaling pathway
    721021 (SHC2)
   04370 VEGF signaling pathway
    721021 (SHC2)
   04072 Phospholipase D signaling pathway
    721021 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    721021 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    721021 (SHC2)
   04062 Chemokine signaling pathway
    721021 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    721021 (SHC2)
   04915 Estrogen signaling pathway
    721021 (SHC2)
   04917 Prolactin signaling pathway
    721021 (SHC2)
   04926 Relaxin signaling pathway
    721021 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    721021 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    721021 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    721021 (SHC2)
   05226 Gastric cancer
    721021 (SHC2)
   05214 Glioma
    721021 (SHC2)
   05220 Chronic myeloid leukemia
    721021 (SHC2)
   05224 Breast cancer
    721021 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    721021 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    721021 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    721021 (SHC2)
   01522 Endocrine resistance
    721021 (SHC2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 721021
NCBI-ProteinID: XP_028695860
LinkDB
Position
19
AA seq 578 aa
MTQGPGGRAPPAPPEPEAPTTFCALLPRMPQWKFAAPGGFLGRGPAAARAAGASGGADPQ
SEPASPGGVPALAAAVLGACEPRCAAPCPLPALSRCRGAGARGPRGARGAAGSGDAAAAE
WIRKGSFIHKPAHGWLHPDARVLGPGVSYVVRYMGCIEVLRSMRSLDFNTRTQVTREAIN
RLHEAVPGVRGSWKKKAPNKALASVLGKSNLRFAGMSISIHISTDGLSLSVPATRQVIAN
HHMPSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSVISTVGQAFELRFKQ
YLHSPPKVALPPERLAGPEESAWGDEEEAVEHSYYNSVPGKEPPPGGLVDSRLALTQPCA
LTALGQGPSASLRDARSLPWDVGSTGAAPPGDGYVQADARGPPDLEEHLYVNTQGLDAPE
PEDSPKKDLFDMRPFEDALKLHECSVAAGMTAAPLPLEDQWPSPPTRRAPVAPTEEQLRQ
EPWYHGRMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRTK
DVLFESISHLIDHHLQNGQPIVAAESELHLRGVVSREP
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgacgcagggtccgggcgggcgcgcgcccccggcgccccccgagcccgaggcgcccacc
accttctgcgcgctgctgccccgaatgccgcagtggaagttcgcggccccgggcggcttc
ctgggtcgcggcccggcggcggcgcgggcggctggggcctcggggggcgcggacccccag
tccgagccggcgagcccggggggcgtcccggcgctggcggccgctgtcctgggcgcctgc
gagccccgctgtgcggcgccctgtcccctgcccgcgctcagccgctgtcggggcgcgggg
gcgcgggggccgcggggcgcgcggggggcggccgggtccggggacgccgccgccgccgag
tggatccggaagggcagcttcatccacaagcccgcgcacggctggctacaccccgacgcc
agggtcctggggcctggggtctcctacgtcgtgcggtacatgggctgcatcgaggtcctc
cgctccatgcgctccctggactttaacacacgcacgcaggtgaccagggaagccatcaac
cggctccacgaggccgtgcctggcgtccggggatcctggaagaaaaaggcccccaacaag
gccctggcgtctgtcctgggcaagagcaaccttcgcttcgccggcatgagcatctccatc
cacatctccaccgacggcctcagcctctccgtgcccgccacgcgccaggtcatcgccaac
caccacatgccatccatctcctttgcatcgggcggagacacggacatgacggattacgtg
gcctacgtcgccaaggaccccatcaaccagagagcctgccacatcctggagtgctgtgaa
ggcctggcccagagcgtcatcagcaccgtcggccaagccttcgagctgcgcttcaagcag
tacctgcacagcccacccaaggtggcactgcccccagaaaggctggcggggccagaggag
tcggcctggggggacgaggaggaggctgtggagcacagttactacaacagcgtcccgggg
aaggagccgccgccgggcgggctggtggactcccggctggccctgacacagccctgcgcc
ctcacagccctcggccagggtccatctgcttctctaagagatgcccgcagcctgccatgg
gacgtggggtccacgggtgcagctccgccaggggacggctacgtgcaggcggacgcccgg
ggccccccggacctggaggagcacctctatgtcaacacgcagggtctggacgcccccgag
ccggaagacagtcccaagaaggatctgtttgacatgcgacccttcgaggatgccctgaag
ctgcatgagtgctcagtggccgcaggtatgacagcagccccccttcccttggaggaccag
tggcccagcccccctacccgccgggcccctgtggcccccacggaggaacagctgcgccag
gagccctggtaccacggccggatgagccgtcgggcggcagagaggatgcttcgagctgac
ggggacttcctcgtgcgagacagcgtcaccaaccccgggcagtacgtcctcaccggcatg
cacgccgggcagcccaagcacctgctgctggtggaccccgagggcgtggtgcggacgaag
gacgtgctgtttgagagcatcagccacctgatcgaccaccacctgcagaacgggcagccc
atcgtggccgccgagagcgagctgcacctgcgcggcgtcgtctcacgggagccctga

DBGET integrated database retrieval system