KEGG   Macaca mulatta (rhesus monkey): 574281
Entry
574281            CDS       T01028                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 precursor
  KO
K05430  interleukin 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc05140  Leishmaniasis
mcc05200  Pathways in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05321  Inflammatory bowel disease
mcc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    574281 (IL4)
   04151 PI3K-Akt signaling pathway
    574281 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574281 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    574281 (IL4)
   04660 T cell receptor signaling pathway
    574281 (IL4)
   04658 Th1 and Th2 cell differentiation
    574281 (IL4)
   04659 Th17 cell differentiation
    574281 (IL4)
   04657 IL-17 signaling pathway
    574281 (IL4)
   04664 Fc epsilon RI signaling pathway
    574281 (IL4)
   04672 Intestinal immune network for IgA production
    574281 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574281 (IL4)
  09163 Immune disease
   05310 Asthma
    574281 (IL4)
   05320 Autoimmune thyroid disease
    574281 (IL4)
   05321 Inflammatory bowel disease
    574281 (IL4)
   05330 Allograft rejection
    574281 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    574281 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    574281 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    574281 (IL4)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   574281 (IL4)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Haparin
  Cytokines
   574281 (IL4)
SSDB
Motif
Pfam: IL4 IL13 Mannosyl_trans3
Other DBs
NCBI-GeneID: 574281
NCBI-ProteinID: NP_001028076
Ensembl: ENSMMUG00000003133
UniProt: Q6U8C1 G7MUA8
LinkDB
Position
6
AA seq 153 aa
MGLTSQLLPPLFFLLACAGNFAHGHNCHIALREIIETLNSLTEQKTLCTKLTITDILAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL
NSCPVKEASQSTLEDFLERLKTIMKEKYSKCRS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac
tttgcccacggacacaactgccatatcgccttacgggagatcatcgaaactctgaacagc
ctcacagagcagaagactctgtgcaccaagttgaccataacggacatccttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcgctgcctgggtgcgactgcacagcagtttcacaggcac
aagcagctgatccgattcctgaaacggctcgacaggaacctctggggcctggcgggcttg
aactcctgtcctgtgaaggaagccagccagagtacgttggaagacttcttggaaaggcta
aagacgatcatgaaagagaaatattcaaagtgtcggagctga

DBGET integrated database retrieval system