KEGG   Macaca mulatta (rhesus monkey): 574285
Entry
574285            CDS       T01028                                 

Gene name
ACTB
Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04145  Phagosome
mcc04210  Apoptosis
mcc04390  Hippo signaling pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04530  Tight junction
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04670  Leukocyte transendothelial migration
mcc04714  Thermogenesis
mcc04810  Regulation of actin cytoskeleton
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04971  Gastric acid secretion
mcc05014  Amyotrophic lateral sclerosis
mcc05100  Bacterial invasion of epithelial cells
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05164  Influenza A
mcc05205  Proteoglycans in cancer
mcc05225  Hepatocellular carcinoma
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    574285 (ACTB)
   04390 Hippo signaling pathway
    574285 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    574285 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    574285 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    574285 (ACTB)
   04520 Adherens junction
    574285 (ACTB)
   04530 Tight junction
    574285 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    574285 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    574285 (ACTB)
   04613 Neutrophil extracellular trap formation
    574285 (ACTB)
   04670 Leukocyte transendothelial migration
    574285 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    574285 (ACTB)
   04919 Thyroid hormone signaling pathway
    574285 (ACTB)
  09154 Digestive system
   04971 Gastric acid secretion
    574285 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    574285 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    574285 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    574285 (ACTB)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    574285 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    574285 (ACTB)
   05410 Hypertrophic cardiomyopathy
    574285 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    574285 (ACTB)
   05414 Dilated cardiomyopathy
    574285 (ACTB)
   05416 Viral myocarditis
    574285 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    574285 (ACTB)
   05135 Yersinia infection
    574285 (ACTB)
   05100 Bacterial invasion of epithelial cells
    574285 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    574285 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mcc03021]
    574285 (ACTB)
   03019 Messenger RNA biogenesis [BR:mcc03019]
    574285 (ACTB)
   03036 Chromosome and associated proteins [BR:mcc03036]
    574285 (ACTB)
   03029 Mitochondrial biogenesis [BR:mcc03029]
    574285 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    574285 (ACTB)
   04147 Exosome [BR:mcc04147]
    574285 (ACTB)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     574285 (ACTB)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     574285 (ACTB)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     574285 (ACTB)
    NuA4 complex
     574285 (ACTB)
  Chromatin remodeling factors
   BAF complex
    574285 (ACTB)
   PBAF complex
    574285 (ACTB)
   SWR1 complex
    574285 (ACTB)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    574285 (ACTB)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     574285 (ACTB)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   574285 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 574285
NCBI-ProteinID: NP_001028256
Ensembl: ENSMMUG00000011153
UniProt: Q6RHR8 F6TIK4 Q6UIS1
LinkDB
Position
3
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgatgatatcgccgcgctcgttgtcgacaacggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgccccccgggccgtcttcccctccatcgtggggcgccccaggcac
cagggcgtgatggtgggcatgggtcagaaggattcatatgtgggcgacgaggcccagagc
aagagaggcattctcaccctgaagtaccccatcgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaatgagctgcgtgtggctcctgaggag
caccccgtgctgctgaccgaggcccccctgaaccccaaggccaaccgcgagaagatgacc
cagatcatgtttgagaccttcaacaccccagccatgtacgtggccatccaggctgtgctg
tccctgtacgcctctggccgtaccactggcatcgtgatggactccggtgacggggtcacc
cacactgtgcccatctatgaggggtatgccctcccccatgccatcctgcgtctggacctg
gctggccgggacctgactgactacctcatgaagatcctcactgagcgcggctacagcttc
accaccacggccgagcgggaaatcgtgcgtgacattaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccacggcggcttccagctcctccctggagaagagctac
gagctgcccgatggccaggtcatcaccattggcaacgagcggttccgctgccctgaggct
ctcttccaaccttccttcctgggcatggagtcctgtggcatccacgaaactaccttcaac
tccatcatgaagtgtgacgtggacatccgtaaagacctgtacgccaacacagtgctgtct
ggtggcaccaccatgtaccctggcattgctgacaggatgcagaaggagattactgccctg
gcgcccagcacgatgaagatcaagatcattgctcctcctgagcgcaagtactctgtgtgg
atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtatgacgagtctggcccttccatcgtccaccgcaaatgcttctag

KEGG   Macaca mulatta (rhesus monkey): 705671
Entry
705671            CDS       T01028                                 

Definition
(RefSeq) actin, cytoplasmic 2-like
  KO
K05692  actin beta/gamma 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04145  Phagosome
mcc04210  Apoptosis
mcc04390  Hippo signaling pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04530  Tight junction
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04670  Leukocyte transendothelial migration
mcc04714  Thermogenesis
mcc04810  Regulation of actin cytoskeleton
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04971  Gastric acid secretion
mcc05014  Amyotrophic lateral sclerosis
mcc05100  Bacterial invasion of epithelial cells
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05164  Influenza A
mcc05205  Proteoglycans in cancer
mcc05225  Hepatocellular carcinoma
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    705671
   04390 Hippo signaling pathway
    705671
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    705671
  09143 Cell growth and death
   04210 Apoptosis
    705671
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    705671
   04520 Adherens junction
    705671
   04530 Tight junction
    705671
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    705671
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    705671
   04613 Neutrophil extracellular trap formation
    705671
   04670 Leukocyte transendothelial migration
    705671
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    705671
   04919 Thyroid hormone signaling pathway
    705671
  09154 Digestive system
   04971 Gastric acid secretion
    705671
  09159 Environmental adaptation
   04714 Thermogenesis
    705671
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    705671
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    705671
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    705671
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    705671
   05410 Hypertrophic cardiomyopathy
    705671
   05412 Arrhythmogenic right ventricular cardiomyopathy
    705671
   05414 Dilated cardiomyopathy
    705671
   05416 Viral myocarditis
    705671
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    705671
   05135 Yersinia infection
    705671
   05100 Bacterial invasion of epithelial cells
    705671
  09172 Infectious disease: viral
   05164 Influenza A
    705671
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mcc03021]
    705671
   03019 Messenger RNA biogenesis [BR:mcc03019]
    705671
   03036 Chromosome and associated proteins [BR:mcc03036]
    705671
   03029 Mitochondrial biogenesis [BR:mcc03029]
    705671
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    705671
   04147 Exosome [BR:mcc04147]
    705671
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     705671
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     705671
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     705671
    NuA4 complex
     705671
  Chromatin remodeling factors
   BAF complex
    705671
   PBAF complex
    705671
   SWR1 complex
    705671
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    705671
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     705671
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   705671
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 705671
NCBI-ProteinID: XP_028700214
LinkDB
Position
2
AA seq 332 aa
MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV
LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTV
PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDF
EQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM
KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG
SILASLSTFQQMWISKQEYDESGPSIVHRKCF
NT seq 999 nt   +upstreamnt  +downstreamnt
atggtgggcatgggtcagaaggattcatatgtgggcgacgaggcccagagcaagagaggc
attctcaccctgaagtaccccatcgagcacggcatcgtcaccaactgggacgacatggag
aagatctggcaccacaccttctacaatgagctgcgtgtggctcctgaggagcaccccgtg
ctgctgaccgaggcccccctgaaccccaaggccaaccgcgagaagatgacccagatcatg
tttgagaccttcaacaccccagccatgtacgtggccatccaggctgtgctgtccctgtac
gcctctggccgtaccactggcatcgtgatggactccggtgacggggtcacccacactgtg
cccatctacgaggggtatgccctcccccatgccatcctgcgtctggacctggctggccgg
gacctgactgactacctcatgaagatcctcactgagcgcggctacagcttcaccaccacg
gccgagcgggaaatcgtgcgtgacattaaggagaagctgtgctatgtcgccctagacttc
gagcaggagatggccacggcggcttccagctcctccctggagaagagctacgagctgccc
gatggccaggtcatcaccattggcaacgagcggttccgctgccctgaggctctcttccaa
ccttccttcctgggcatggagtcctgtggcatccacgaaactaccttcaactccatcatg
aagtgtgacgtggacatccgtaaagacctgtacgccaacacagtgctgtctggtggcacc
accatgtaccctggcattgctgacaggatgcagaaggagattactgccctggcgcccagc
acgatgaagatcaagatcattgctcctcctgagcgcaagtactctgtgtggatcggcggc
tccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcaggagtatgac
gagtctggcccttccatcgtccaccgcaaatgcttctag

KEGG   Macaca mulatta (rhesus monkey): 713687
Entry
713687            CDS       T01028                                 

Gene name
ACTG1
Definition
(RefSeq) actin, cytoplasmic 2
  KO
K05692  actin beta/gamma 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04145  Phagosome
mcc04210  Apoptosis
mcc04390  Hippo signaling pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04530  Tight junction
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04670  Leukocyte transendothelial migration
mcc04714  Thermogenesis
mcc04810  Regulation of actin cytoskeleton
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04971  Gastric acid secretion
mcc05014  Amyotrophic lateral sclerosis
mcc05100  Bacterial invasion of epithelial cells
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05164  Influenza A
mcc05205  Proteoglycans in cancer
mcc05225  Hepatocellular carcinoma
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
mcc05416  Viral myocarditis
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    713687 (ACTG1)
   04390 Hippo signaling pathway
    713687 (ACTG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    713687 (ACTG1)
  09143 Cell growth and death
   04210 Apoptosis
    713687 (ACTG1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    713687 (ACTG1)
   04520 Adherens junction
    713687 (ACTG1)
   04530 Tight junction
    713687 (ACTG1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    713687 (ACTG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    713687 (ACTG1)
   04613 Neutrophil extracellular trap formation
    713687 (ACTG1)
   04670 Leukocyte transendothelial migration
    713687 (ACTG1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    713687 (ACTG1)
   04919 Thyroid hormone signaling pathway
    713687 (ACTG1)
  09154 Digestive system
   04971 Gastric acid secretion
    713687 (ACTG1)
  09159 Environmental adaptation
   04714 Thermogenesis
    713687 (ACTG1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    713687 (ACTG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    713687 (ACTG1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    713687 (ACTG1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    713687 (ACTG1)
   05410 Hypertrophic cardiomyopathy
    713687 (ACTG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    713687 (ACTG1)
   05414 Dilated cardiomyopathy
    713687 (ACTG1)
   05416 Viral myocarditis
    713687 (ACTG1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    713687 (ACTG1)
   05135 Yersinia infection
    713687 (ACTG1)
   05100 Bacterial invasion of epithelial cells
    713687 (ACTG1)
  09172 Infectious disease: viral
   05164 Influenza A
    713687 (ACTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mcc03021]
    713687 (ACTG1)
   03019 Messenger RNA biogenesis [BR:mcc03019]
    713687 (ACTG1)
   03036 Chromosome and associated proteins [BR:mcc03036]
    713687 (ACTG1)
   03029 Mitochondrial biogenesis [BR:mcc03029]
    713687 (ACTG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    713687 (ACTG1)
   04147 Exosome [BR:mcc04147]
    713687 (ACTG1)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     713687 (ACTG1)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     713687 (ACTG1)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     713687 (ACTG1)
    NuA4 complex
     713687 (ACTG1)
  Chromatin remodeling factors
   BAF complex
    713687 (ACTG1)
   PBAF complex
    713687 (ACTG1)
   SWR1 complex
    713687 (ACTG1)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    713687 (ACTG1)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     713687 (ACTG1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   713687 (ACTG1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 713687
NCBI-ProteinID: XP_014976066
Ensembl: ENSMMUG00000012054
UniProt: F6TII3
LinkDB
Position
16
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaagagatcgccgccctcgtcattgacaatggctccggcatgtgcaaagctggc
tttgctggggacgatgcaccccgagccgtgtttccctccatcgtcgggcgcccccgacac
cagggcgtgatggtgggcatgggccagaaggactcctacgtgggtgacgaggcccagagc
aagcgcggcatcttgaccctgaagtaccctattgagcatggcattgtcaccaactgggac
gacatggagaaaatctggcaccatactttctacaatgagctgcgcgtggccccagaggag
cacccggtgctgctgaccgaggcccctctgaaccctaaggccaacagagagaagatgact
cagattatgtttgagaccttcaacaccccggccatgtacgtggccatccaggctgtgctg
tccctctacgcctctgggcgcaccactggcattgtcatggactctggcgacggggtcacc
cacacggtgcccatctacgagggctacgccctcccccacgccatcctgcgtctggacctg
gctggccgggacctgactgactacctcatgaagatcctcaccgagcgtggctacagcttc
accaccacggccgagcgggaaattgtgcgcgacatcaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccaccgccgcatcgtcctcttccctggagaagagctac
gagctgcctgatggccaggtcatcaccatcggcaatgagcggttccggtgtccggaggcg
ctgttccagccgtctttcctgggcatggaatcttgtggcatccatgagaccacctttaac
tccatcatgaagtgtgacgtggacatccgcaaagacctgtatgccaacacggtgctgtct
ggtggcaccaccatgtacccaggcattgccgacaggatgcagaaggagatcactgccctg
gcacccagcaccatgaagatcaagatcatcgcacccccagagcgcaagtactcagtgtgg
atcggtggctccatcttggcctcactgtccaccttccagcagatgtggattagcaagcag
gagtacgacgagtcgggcccctccatcgtccatcgcaaatgcttctaa

DBGET integrated database retrieval system