KEGG   Macaca mulatta (rhesus monkey): 574293
Entry
574293            CDS       T01028                                 

Gene name
AR
Definition
(RefSeq) androgen receptor
  KO
K08557  androgen receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04114  Oocyte meiosis
mcc05200  Pathways in cancer
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    574293 (AR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574293 (AR)
  09162 Cancer: specific types
   05215 Prostate cancer
    574293 (AR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    574293 (AR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcc03310]
    574293 (AR)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    574293 (AR)
Nuclear receptors [BR:mcc03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   574293 (AR)
SSDB
Motif
Pfam: Androgen_recep Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 574293
NCBI-ProteinID: NP_001028083
Ensembl: ENSMMUG00000011437
UniProt: Q6QT55
LinkDB
Position
X
AA seq 895 aa
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLQQQQQQ
QQETSPRQQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSAPECHPERGCVPEPGA
AVAAGKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQ
QQEAVSEGSSSGRAREASGAPTSSKDNYLEGTSTISDSAKELCKAVSVSMGLGVEALEHL
SPGEQLRGDCMYAPVLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYT
KGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPP
PPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHT
LFTAEEGQLYGPCGGGGGGGGGGGGGAGEAGAVAPYGYTRPPQGLAGQEGDFTAPDVWYP
GGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGD
EASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGM
TLGARKLKKLGNLKLQEEGEASSTTSPTEETAQKLTVSHIEGYECQPIFLNVLEAIEPGV
VCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGL
MVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEF
LCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLD
SVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
NT seq 2688 nt   +upstreamnt  +downstreamnt
atggaggtgcagttagggctggggagggtctaccctcggccgccgtccaagacctaccga
ggagctttccagaatctgttccagagcgtgcgcgaagtgatccagaacccgggccccagg
cacccagaggccgcgagcgcagcacctcccggcgccagtttgcagcagcagcagcagcag
cagcaagaaactagcccccggcaacagcagcagcagcagcagggtgaggatggttctccc
caagcccatcgtagaggccccacaggctacctggtcctggatgaggaacagcagccttca
cagcctcagtcagccccggagtgccaccccgagagaggttgcgtcccagagcctggagcc
gccgtggccgccggcaaggggctgccgcagcagctgccagcacctccggacgaggatgac
tcagctgccccatccacgttgtctctgctgggccccactttccccggcttaagcagctgc
tccgccgaccttaaagacatcctgagcgaggccagcaccatgcaactccttcagcaacag
cagcaggaagcagtatccgaaggcagcagcagcgggagagcgagggaggcctcgggggct
cccacttcctccaaggacaattacttagagggcacttcgaccatttctgacagcgccaag
gagctgtgtaaggcagtgtcggtgtccatgggcttgggtgtggaggcgttggagcatctg
agtccaggggaacagcttcggggggattgcatgtacgccccagttttgggagttccaccc
gctgtgcgtcccactccgtgtgccccattggccgaatgcaaaggttctctgctagacgac
agcgcaggcaagagcactgaagatactgctgagtattcccctttcaagggaggttacacc
aaagggctagaaggcgagagcctaggctgctctggcagcgctgcagcagggagctccggg
acacttgaactgccgtccaccctgtctctctacaagtccggagcactggacgaggcagct
gcgtaccagagtcgcgactactacaactttccactggctctggccgggccgccgccccct
ccaccgcctccccatccccacgctcgcatcaagctggagaacccgctggactatggcagc
gcctgggcggctgcggcggcgcagtgccgctatggggacctggcgagcctgcatggcgcg
ggtgcagcgggacccggctctgggtcaccctcagcggccgcttcctcatcctggcacact
ctcttcacagccgaagaaggccagttgtatggaccgtgtggtggtgggggcggcggcggt
ggcggcggcggcggcggcgcaggcgaggcgggagctgtagccccctacggctacactcgg
ccacctcaggggctggcgggccaggaaggcgacttcaccgcacctgatgtgtggtaccct
ggcggcatggtgagcagagtgccctatcccagtcccacttgtgtcaaaagcgagatgggc
ccctggatggatagctactccggaccttacggggacatgcgtttggagactgccagggac
catgttttgccaattgactattactttccaccccagaagacctgcctgatctgtggagat
gaagcttctgggtgtcactatggagctctcacatgtggaagctgcaaggtcttcttcaaa
agagccgctgaagggaaacagaagtacctgtgtgccagcagaaatgattgcactattgat
aaattccgaaggaaaaattgtccatcttgccgtcttcggaaatgttatgaagcagggatg
actctgggagcccggaagctgaagaaacttggtaatctgaaactacaggaggaaggagag
gcttccagcaccaccagccccactgaggagacagcccagaagctgacagtgtcacacatt
gaaggctatgaatgtcagcccatctttctgaatgtcctggaggccattgagccaggtgtg
gtgtgtgctggacatgacaacaaccagcccgactccttcgcagccttgctctctagcctc
aatgaactgggagagagacagcttgtacatgtggtcaagtgggccaaggccttgcctggc
ttccgcaacttacacgtggacgaccagatggctgtcattcagtactcctggatggggctc
atggtgtttgccatgggctggcgatccttcaccaatgtcaactccaggatgctctacttt
gcccctgatctggttttcaatgagtaccgcatgcacaaatcccggatgtacagccagtgt
gtccgaatgaggcacctctctcaagagtttggatggctccaaatcaccccccaggaattc
ctgtgcatgaaagcgctgctactcttcagcattattccagtggatgggctgaaaaatcaa
aaattctttgatgaacttcgaatgaactacatcaaggaactcgatcgtatcattgcatgc
aaaagaaaaaatcccacatcctgctcaaggcgtttctaccagctcaccaagctcctggac
tccgtgcagcctattgcgagagagctgcatcagttcacttttgacctgctaatcaagtca
cacatggtgagcgtggactttccggaaatgatggcagagatcatctctgtgcaagtgccc
aagatcctttctgggaaagtcaagcccatctatttccacacccagtga

DBGET integrated database retrieval system