KEGG   Macaca mulatta (rhesus monkey): 574312
Entry
574312            CDS       T01028                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1 isoform X1
  KO
K05719  integrin beta 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04514  Cell adhesion molecules
mcc04530  Tight junction
mcc04611  Platelet activation
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05100  Bacterial invasion of epithelial cells
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05145  Toxoplasmosis
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05222  Small cell lung cancer
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    574312 (ITGB1)
   04151 PI3K-Akt signaling pathway
    574312 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    574312 (ITGB1)
   04514 Cell adhesion molecules
    574312 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    574312 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    574312 (ITGB1)
   04530 Tight junction
    574312 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    574312 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    574312 (ITGB1)
   04670 Leukocyte transendothelial migration
    574312 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    574312 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574312 (ITGB1)
   05205 Proteoglycans in cancer
    574312 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    574312 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    574312 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    574312 (ITGB1)
   05414 Dilated cardiomyopathy
    574312 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    574312 (ITGB1)
   05133 Pertussis
    574312 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    574312 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    574312 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    574312 (ITGB1)
   05140 Leishmaniasis
    574312 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    574312 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    574312 (ITGB1)
   04515 Cell adhesion molecules [BR:mcc04515]
    574312 (ITGB1)
   04090 CD molecules [BR:mcc04090]
    574312 (ITGB1)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    574312 (ITGB1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   574312 (ITGB1)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin beta subunits
   574312 (ITGB1)
CD molecules [BR:mcc04090]
 Proteins
  574312 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 574312
NCBI-ProteinID: XP_015002262
Ensembl: ENSMMUG00000017767
LinkDB
Position
9
AA seq 801 aa
MNLQLIFWIGLISSICCVFGQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQEN
PIYKSPINNFKNPNYGRKAGL
NT seq 2406 nt   +upstreamnt  +downstreamnt
atgaatttacaactgattttctggattggactgatcagttcaatttgctgtgtgtttggt
caaacagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtgggtggtgcacaaattcaacatttttacaggaaggaatgcccact
tctgcacgatgtgatgatttagaagccttaaaaaagaagggttgccctccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctcaagccagaggatattactcagatccaaccacagcagttggtt
ttgcgattaagatcaggggagccacagacatttacattaaaattcaagagagctgaagac
tatcctattgacctctactaccttatggacctgtcttactcaatgaaagacgatttggag
aatgtaaaaagtcttggaacagatctgatgaatgaaatgaggaggattacgtctgacttc
agaattggatttggttcatttgtggaaaagactgtgatgccttacattagcacaacacca
gctaagctcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctacaaa
aatgtgctcagtcttactaataaaggagaagtatttaatgaacttgttggaaaacagcgc
atatctggaaatttggattctccagaaggtggttttgatgccatcatgcaagttgcagtt
tgtggatcactgattggctggaggaatgttacacggctgctggtgttttccacagatgcc
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacag
tgtcacctggaaaataatatgtacacaatgagtcattattatgattatccttctattgct
caccttgtccagaaactgagtgaaaataatattcagacaatttttgcagttactgaagaa
tttcagcccgtttacaaggaactgaaaaacttgatccctaagtcagcagtaggaacatta
tctgcaaattctagtaatgtaattcagttgatcattgatgcatacaattccctttcctca
gaagtcattttggaaaacggcaaattgtcagaaggagtaacaataagttacaaatcttac
tgcaagaacggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataagtgtccaaaaaaggattct
gacagctttaaaattaggcctctgggcttcacggaggaagtagaggttattcttcagtac
atctgtgaatgtgaatgccaaagcgaaggcatccctgaaagtcccaagtgtcatgaagga
aatgggacgtttgagtgtggcgcgtgcaggtgcaacgaagggcgtgttggtagacattgt
gaatgcagcacagatgaagttaacagtgaagacatggacgcttactgcagaaaagaaaac
agttcagaaatctgcagtaacaatggagagtgcgtttgtggacagtgtgtttgtaggaag
agggataatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgcaaccccaactacactggcagtgcatgtgactgttctttggatactagtacttgcgaa
gccagcaacggacagatctgtaatggccggggcatctgcgaatgtggtgtctgtaagtgt
acagatccgaagttccaagggcaaacatgtgagatgtgtcagacctgccttggtgtctgt
gctgagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgcacacaggaatgttcctattttaacattaccaaggtagaaagtcgggacaaattaccc
cagccagtccaacctgatcctgtgtcccattgtaaggagaaggatgttgacgactgttgg
ttctattttacatattcagtgaatgggaacaatgaggtcatggttcatgttgtggagaat
ccagagtgtcccactggtccagacatcattccaattgtagctggtgtggttgctggaatt
gttcttattggccttgcattactgctgatatggaagcttttaatgataattcatgacaga
agggagtttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacacaagaaaat
ccgatttacaagagtcctattaataatttcaagaatccaaactacggacgtaaagctggt
ctctaa

KEGG   Macaca mulatta (rhesus monkey): 699405
Entry
699405            CDS       T01028                                 

Gene name
ITGB7
Definition
(RefSeq) integrin beta-7
  KO
K06590  integrin beta 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04514  Cell adhesion molecules
mcc04672  Intestinal immune network for IgA production
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05202  Transcriptional misregulation in cancer
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    699405 (ITGB7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    699405 (ITGB7)
   04514 Cell adhesion molecules
    699405 (ITGB7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    699405 (ITGB7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    699405 (ITGB7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    699405 (ITGB7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    699405 (ITGB7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    699405 (ITGB7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    699405 (ITGB7)
   05414 Dilated cardiomyopathy
    699405 (ITGB7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    699405 (ITGB7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    699405 (ITGB7)
   04515 Cell adhesion molecules [BR:mcc04515]
    699405 (ITGB7)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   699405 (ITGB7)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin beta subunits
   699405 (ITGB7)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 699405
NCBI-ProteinID: XP_015007318
Ensembl: ENSMMUG00000005245
UniProt: F7BVZ0
LinkDB
Position
11
AA seq 798 aa
MVALPVVLVLLLVLSRGESELDAKTPSTGEATEWGNPHLSLLGSCQPAPSCQKCIVSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRITLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKTEG
KAEDRGQCNHVQINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQAQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSEAELSSLDLESGCRAPNGTGPLCSGK
GQCQCGHCSCNGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCSDGYYGALCDQCPGCKTPCERHRDCAECGAFGTG
LLATNCSTACAHTNVTLVLAPILDDGWCKERTLDNHLFFFLVEDDARGRVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPIL
NT seq 2397 nt   +upstreamnt  +downstreamnt
atggtggctttgccagtggtccttgttttgctgctggtcctgagcagaggtgagagtgag
ttggacgccaagaccccatccacaggggaggccacagaatgggggaatcctcacctgtcc
ctgctggggtcctgccagccagccccctcctgccagaagtgcatcgtctcacaccccagc
tgtgcatggtgcaagcaactgaacttcaccgcgtcgggggaggcggaggcacggcgctgc
gcccgacgagaggagctgctggctcgaggctgcccgctggaggagctggaggagccccgc
ggccagcaggaggtgctgcaggaccagccgctcagccagggcgcccgcggagagggtgcc
actcagctggcgccgcagcgggtccggatcacgctacggcctggagagccccagcagctc
caggtccgcttccttcgtgctgagggatacccggtggacctgtactaccttatggacctg
agctactccatgaaggacgacctggaacgcgtgcgccagcttgggcacgctctgctggtc
cggctgcaggaagtcacccattctgtgcgcattggttttggttcctttgtggacaaaacg
gtgctgccctttgtgagcacagtaccctccaagctgcgccacccctgccccacacggctg
gagcgctgccagtcacccttcagctttcaccatgtgctgtccctgacgggggatgcgcaa
gccttcgagcgggaggtggggcgccagagcgtgtccggcaatctggactcgcctgaaggt
ggcttcgatgccattctgcaggctgcactctgccaggagcagattggctggagaaatgtg
tcccggctgctggtgttcacttcagatgacacattccatacggctggggacgggaagttg
ggtggcattttcatgcccagtgatgggcactgccacttggacagcaatggcctctacagt
cgcagcacagagtttgactacccctctgtgggtcaggtagcccaggccctctctgcagca
aacatccagcccatctttgctgtcaccagtgctgcactgcctgtctaccaggagctgagt
aagctgattcctaagtctgcggttggggagctgagtgaggactccagcaatgtggtacag
ctcatcatggatgcttataatagcctgtcttccactgtgacccttgaacactcttcactc
cctcctggggtccacatttcttacgaatcccagtgtgagggtcctgagaagacggagggt
aaggctgaggatcgaggacagtgcaaccatgtccaaatcaaccagacggtgactttctgg
gtttccctccaagccacccactgcctcccagagccccatctcctgaggctccgggccctt
ggcttctcagaggagctgattgtggagttgcacacgctgtgtgactgtaactgcagtgac
acccaggcccaggctccccactgcagtgatggccagggacacctacaatgtggggtatgc
agctgtgcccccggccgcctaggccggctctgtgagtgctctgaggctgagctgtcctcc
ttagatctggaatctgggtgccgggctcccaatggcacagggcccctatgcagcggaaag
ggtcagtgccaatgtggacactgcagctgcaatggacagagctctggacatctgtgcgag
tgtgacgatgccagctgtgagcgacatgagggcatcctctgtggaggctttggtcgctgc
caatgtggagtatgtcactgtcatgccaaccgcacgggcagagcatgcgaatgcagtggg
gacatggacagttgcatcagtcccgagggagggctctgcagtgggcatggacgctgcaaa
tgcaaccgctgccagtgctcggatggctactacggtgctctatgtgaccaatgcccaggc
tgcaagacaccatgtgagagacaccgggactgtgcagagtgtggggcctttgggactggc
ctcctggccaccaattgcagtacagcttgtgcccataccaatgtgaccctggtcttggcc
cctatcttggatgatggctggtgcaaagagaggaccctggacaaccacttgttcttcttc
ttggtggaggatgacgccagaggcagggtcgtgctcagagtgagaccccaagaaaaggga
gcagaccacacccaggccattgtgctgggctgcgtagggggcatcgtggcagtggggctg
gggctggtcctggcttaccggctctcggtggaaatctatgaccgccgggaatacagtcgc
tttgagaaggagcagcaacaactcaactggaagcaggacagtaatcctctctacaaaagt
gccatcacgaccaccatcaatcctcgctttcaagaggcagacagtcccattctctga

KEGG   Macaca mulatta (rhesus monkey): 700454
Entry
700454            CDS       T01028                                 

Gene name
ITGB6
Definition
(RefSeq) integrin beta-6 isoform X1
  KO
K06589  integrin beta 6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    700454 (ITGB6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    700454 (ITGB6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    700454 (ITGB6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    700454 (ITGB6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    700454 (ITGB6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    700454 (ITGB6)
   05414 Dilated cardiomyopathy
    700454 (ITGB6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    700454 (ITGB6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    700454 (ITGB6)
   04515 Cell adhesion molecules [BR:mcc04515]
    700454 (ITGB6)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   700454 (ITGB6)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin beta subunits
   700454 (ITGB6)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 700454
NCBI-ProteinID: XP_014965716
Ensembl: ENSMMUG00000002678
UniProt: G7N858 A0A1D5QZT0
LinkDB
Position
12
AA seq 788 aa
MGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQCAWCAQENFTRPSGVGERCD
TPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQT
LQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEK
PVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTFFQHQKKCSHMKVGDTASFNVT
VNIPNCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCA
CHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGDNGDCDCGECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCG
KCVCANPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEE
DFSKDGSVSCSLQGENECLITFLITTDNEGKSIIHSISEKDCPKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KVDLSTDG
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggggattgaactgctttgcctgttctttctatttctaggaaggaatgatcacgtacaa
ggtggctgtgccctgggaggtgcagaaacctgtgaagactgcctgctcattggacctcag
tgtgcctggtgtgctcaggagaattttacccgtccatctggagttggtgaaaggtgtgat
accccagcaaaccttttagctaaaggatgtcaattaaacttcatcgaaaaccctgtctcc
caagtagaaatacttaaaaataagcctctcagtgtaggcagacagaaaaatagttctgac
attgttcagattgcacctcaaagcttgatccttaagttgagaccaggtggtgcgcagact
ctgcaggtgcatgtccgccagactgaggactacccggtggatttgtattacctcatggac
ctctccgcctccatggatgatgacctcaacacaatcaaggagttgggctcccggctttcc
aaagagatgtctaaattaaccagcaactttagactgggcttcggatcttttgtggaaaaa
cctgtatccccttttgtgaaaacaacaccagaagaaattgccaacccttgcagtagtatt
ccatacttctgtttacctacatttggattcaagcacattttgccattgacaaatgatgct
gaaagattcaatgaaattgtgaagaatcagaaaatttctgctaatatcgacacacctgaa
ggtggatttgatgcaattatgcaagctgctgtgtgtaaggaaaaaattggttggcggaat
gattccctccacctcctggtctttgtgagtgatgctgattctcattttggaatggacagc
aaactggcaggcatcgtcattcctaatgatgggctctgtcacttggacagcaagaatgaa
tactccatgtcaactgtcttggaatatccaacaattggacaactcattgataaactggta
caaaacaacgtgttattgatcttcgctgtaacccaagaacaagttcatttatatgagaat
tacgcaaaacttattcctggagctacagtagggctacttcagaaggactccggaaacatt
ctccagctgatcatctcagcttatgaagaactgcggtctgaggtggaactggaagtatta
ggagacactgaaggactcaacttgtcatttacagccatctgtaacaacggtacattcttc
caacaccaaaagaaatgctctcacatgaaagtgggagacacagcttccttcaatgtgact
gtgaatatcccaaactgtgagagaagaagcaggcacattatcataaagcctgtgggactg
ggggacgccctggaattacttgtcagtccagaatgcaactgcgactgtcagaaagaagtg
gaagtgaacagctccaagtgtcaccacgggaacggctccttccagtgtggggtgtgtgcc
tgccaccctggccacatggggcctcgctgtgagtgtggcgaggacatgctgagcacagat
tcctgcaaggaggccccagatcatccctcctgcagtggaaggggtgactgctactgtgga
cagtgtatctgccacttgtctccctatggaaacatttatgggccttattgccagtgtgac
aatttttcctgcgtgagacacaaagggctgctctgcggagacaacggcgactgtgactgt
ggtgagtgtgtatgcaggagcggctggactggcgagtactgcaactgcaccaccagcacg
gactcctgcgtctctgaagacggagttctctgcagcgggcgtggggactgcgtttgtggc
aagtgtgtttgcgcaaacccgggagcctcaggaccaacctgtgaacgatgtcctacctgt
ggtgacccctgtaactctaaacggagctgcattgagtgccacctgtcagcagctggccaa
gcccgagaagaatgtgtggacaagtgcaaactagctggtgcgaccatcagtgaagaagaa
gatttctcaaaggatggttctgtttcctgctctctgcaaggagaaaatgaatgtcttatt
acattcctgataactacagataatgaggggaaaagcatcattcacagcatcagtgaaaaa
gattgtccaaagcctccaaacattcccatgatcatgttgggggtttccctggctattctt
ctcatcggggttgtcctgctgtgcatctggaagctgctggtgtcatttcatgatcgtaaa
gaagttgccaaatttgaagcagaacggtcaaaagccaagtggcaaacgggaaccaatcca
ctctacagaggctccacgagtacttttaaaaatgtaacttataaacacagggaaaaacaa
aaggtggacctttccacagatggatag

KEGG   Macaca mulatta (rhesus monkey): 703770
Entry
703770            CDS       T01028                                 

Gene name
ITGB4
Definition
(RefSeq) integrin beta-4 isoform X4
  KO
K06525  integrin beta 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    703770 (ITGB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    703770 (ITGB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    703770 (ITGB4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    703770 (ITGB4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    703770 (ITGB4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    703770 (ITGB4)
   05414 Dilated cardiomyopathy
    703770 (ITGB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    703770 (ITGB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    703770 (ITGB4)
   04515 Cell adhesion molecules [BR:mcc04515]
    703770 (ITGB4)
   04090 CD molecules [BR:mcc04090]
    703770 (ITGB4)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   703770 (ITGB4)
  Exosomal proteins of bladder cancer cells
   703770 (ITGB4)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin beta subunits
   703770 (ITGB4)
CD molecules [BR:mcc04090]
 Proteins
  703770 (ITGB4)
SSDB
Motif
Pfam: Integrin_beta fn3 Calx-beta Integrin_B_tail I-EGF_1 PSI_integrin Pur_ac_phosph_N EGF_2 SEA
Other DBs
NCBI-GeneID: 703770
NCBI-ProteinID: XP_014975879
Ensembl: ENSMMUG00000021763
UniProt: F7DF99
LinkDB
Position
16
AA seq 1823 aa
MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRR
CNTQAELLAAGCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFEL
EVFEPRESPVDLYILMDFSNSMSDDLDNLKKMGQNLAQVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDERCHLDATGTYTQYR
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGFRTEVTSKMFQKMKTGSFQIQRGEVGIYQVQLRAIEHVDG
THVCQLPKEDQKGNIHLKPSFSDGLKMDAGIICDVCPCELQKEVRSARCNFNGDFMCGQC
VCSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYD
NFQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECG
RCHCHQQSLYTDTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVD
ELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPSSFWWLIPLLL
LLLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPML
RSGNLKGRDVVRWKVTNNVQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTRE
CAQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALL
KLTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDEEKQ
LLVEAIDVPAGTATLGRRLVNITIIKEQARDVVSFEQPEYSVSRGDQVARIPVIRRVLDG
GKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELEEVDSLLRGRQIRRF
HVQLSNPKFGAHLGQPHSTTIIIRDPDELDRSLTSQMVSSQPPSHGDLGAPQNPNAKAAG
SRKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAY
GAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGL
VNDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ
PKRPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTGCGWKFEPLL
GEELDLRRVTWRLPPELIPRLSASSGRSSDAEAPHGPPEDGGAGGKGGSLPRSATPGPPG
EHLVNGRMDFAFPGSANSLHRMTTTGAAAYGTHLSPHVPHRGLSTSSTLTRDYHSLTRSE
HSHSTTLPRDYSTLTSVSSHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQG
YSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIE
SQVHPQSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCE
MAQGGGPATTFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDG
GPFPQLGSHAGLFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQE
FVSRTLTTSGTLSTQVDQQFFQT
NT seq 5472 nt   +upstreamnt  +downstreamnt
atggcagggccacgccccagcccatgggccaggctgctactggcagccttgatcagcgtc
agcctctctgggaccttggcaaaccgctgcaagaaggccccagtgaagagctgcacggag
tgtgtccgtgtggataaggactgcgcctactgcacggacgagatgttcagggaccggcgc
tgcaacacccaggcggagctgctggccgcaggctgtcagcgcgagagcatcgtggtcatg
gagagcagcttccagattacagaggagacccagattgacaccaccctgcggcgcagccag
atgtccccccagggcctgcgggtccggctgcggcccggtgaggagcggcactttgagctg
gaagtgtttgagccccgggagagccccgtggacctgtacatcctcatggacttctccaac
tccatgtccgatgatctggacaacctcaagaagatggggcagaacttggctcaggtcctg
agccagctcaccagtgactacactattggatttggcaagtttgtggacaaagtcagcgtc
ccgcagacagacatgaggcctgagaagctgaaggagccctggcccaacagtgaccccccc
ttctccttcaagaacgtcatcagcctgacagaagatgtggatgagttccggaataaactg
cagggggagaggatctcaggcaacctggacgctcctgagggcggcttcgatgccatcctg
cagacggccgtgtgcacgagggacattggctggcgcccggacagcacccacctgctggtc
ttctccaccgagtcggccttccactatgaggctgacggtgccaatgtgctggctggcatc
atgagccgcaacgatgaacggtgccacctggacgccacgggcacctacacccagtacagg
acacaggactacccgtcggtgcccaccctggtgcgcctgctcgccaagcacaacatcatc
cctatctttgctgtcaccaactactcctacagctactacgagaagcttcacacctatttc
cctgtctcctcgctgggggtgctgcaggaggactcgtccaacatcgtggagctgctggag
gaggccttcaatcgaatccgctccaacctggacatccgggccctagacagcccccgaggc
tttcggacagaggtcacctccaagatgttccagaagatgaagactgggtcctttcagatc
cagcggggggaagtgggcatataccaggtgcagctgcgggccatcgagcacgtggatggg
acgcacgtgtgccagctgccgaaggaggaccagaagggcaacatccatctgaaaccttcc
ttctctgatggcctcaagatggacgcgggcatcatctgtgatgtgtgcccctgcgagctg
caaaaagaggtgcggtcagctcgctgcaacttcaatggagacttcatgtgtggacagtgt
gtgtgcagtgagggctggagtggccagacctgcaactgctccaccggctctctgagtgac
attcagccctgcctgcgggagggtgaggacaagccatgctcgggccgtggggagtgccag
tgcgggcactgtgtgtgctacggcgaaggccgctacgagggtcagttctgcgagtatgac
aacttccagtgtccccgcacttctgggttcctctgcaatgaccgaggacgctgctccatg
ggccagtgtgtgtgtgagcctggttggacaggcccaagctgtgactgtcccctcagcaat
gccacctgcatcgacagcaatgggggcatctgtaatggacgtggccactgtgagtgtggc
cgctgccactgccaccagcagtcgctttacacggacaccatctgcgagatcaactactca
gcgatccacccgggcctctgcgaggacctacgctcctgcgtgcagtgccaggcatggggc
accggggagaagaaggggcgcacgtgtgaggaatgcaacttcaaggtcaagatggtggac
gagcttaagagagccgaggaggtggtggtgcgctgctccttccgggacgaggacgatgac
tgcacctacagctacaccatggaaggcgacggcgcccctgggcccaacagcaccgtcctg
gtgcacaagaagaaggactgccctcccagctccttctggtggctcatccccctgctcctc
ctcctcctgccgctcctggccctgctgctgctgctctgctggaagtactgcgcctgctgc
aaggcctgcctggcacttctcccttgctgcaaccgaggtcacatggtgggctttaaggaa
gaccactacatgctgcgggagaacctgatggcctcagaccacctggacacgcccatgctg
cgcagcgggaacctcaagggccgtgacgtggtccgctggaaggtcaccaacaacgtgcag
cggcctggctttgccactcatgccgccagcatcaaccccacagaactggtgccctacggg
ctgtccttgcgcctggcccgcctttgcaccgagaacctgctaaagcctgacactcgggag
tgtgcccagctgcgccaggaggtggaggagaacctgaacgaagtctacaggcagatctcc
ggtgtacacaagctccagcagaccaagttccggcagcagcccaatgctgggaaaaagcaa
gaccacaccattgtggacacagtgctgatggcgccccgctcggccaagccagccctgctg
aagcttacagagaagcaggtggaacagagggcctttcatgacctcaaggtggcccccggc
tactacaccctcactgcagaccaggacgcccggggcatggtggagttccaggagggtgtg
gagctggtggacgtacgggtgcccctctttatccggcctgaggacgacgaggagaagcag
ctgctggtggaggccatcgatgtacctgcgggcactgccacccttggccgccgcctggta
aacatcaccatcatcaaggagcaagccagagatgtggtgtcctttgagcagcctgagtac
tcggtcagccgtggggaccaggtggctcgcatccctgtcatccggcgcgtcctggacggc
gggaagtctcaggtctcctaccgcacgcaggatggcactgcacagggcaaccgggactac
atccctgtggagggtgagctgctgttccagcctggagaggcctggaaagagctgcaggtg
aagctcctggagctggaagaggtcgactcccttctgcggggccgccagatccgccgtttc
cacgtacagctcagcaaccctaagtttggggcccacctgggccagccccactccaccacc
atcatcatcagggacccagatgagctggaccggagcctcacgagtcagatggtgtcatca
cagccaccctctcacggtgacctgggcgccccgcagaaccccaatgctaaggccgctggg
tccaggaagatccatttcaactggctgcccccttctggcaagccaatggggtacagggta
aagtactggattcagggtgactctgagtccgaagcccacctgctcgacagcaaggtgccc
tcagtggagctcaccaacctgtacccgtattgcgactatgagatgaaggtgtgcgcctac
ggggctcagggcgagggaccctacagctccctagtgtcctgccgcacccaccaggaagtg
cccagcgagccagggcgtctggccttcaatgtcgtctcctccacggtgacccagctgagc
tgggccgagccggctgagaccaacggtgagatcacagcctacgaggtctgctatggcctg
gtcaacgacgacaaccgacctatcgggcccatgaagaaggtgctggttgacaatcctaag
aaccggatgctgctcattgagaaccttcgggagtcccagccctaccgctacacggtgaag
gcgcgcaacggggccggctgggggcctgagcgggaggccatcatcaacctggccacccaa
cccaagcggcccatgtccatccccatcatccctgacatccccatcgtggacgcccagagc
ggggaggactacgacagcttccttatgtacagcgatgatgttctacgctctccatctggc
agccagaggcccagcgtctctgatgacaccggctgcggctggaagttcgagcccctgctg
ggggaggagctggacctgcggcgcgtcacgtggcggctgcccccggagctcatcccgcgc
ctgtcggccagcagcgggcgctcctccgacgccgaggcgccccacgggcccccggaggac
ggcggcgcgggcgggaaggggggcagcctgccccgcagtgcgacacccgggccccccgga
gagcacctagtgaatggccggatggactttgccttcccgggcagcgccaactccctgcac
aggatgaccacgaccggtgccgctgcctatggaacccacctgagcccccacgtgccccac
cgaggactaagcacatcctccaccctcacacgggactaccactcgctgacccgctcggaa
cactcacactcgaccacactgcccagggactactccaccctcacctccgtctcctcccac
gactctcgcctgaccgctggtgtgcccgacacgcccacccgcctggtgttctctgccctg
ggacccacatctctcagagtgagctggcaggagccacggtgcgagcggccgctgcagggc
tacagcgtggagtaccagctgctgaacggcggcgagctacatcggctcaacatccccaac
cctgcccagacctcagtggtggtggaagacctcctgcccaaccactcctatgtgttccgc
gtgcgggcccagagccaggaaggctggggccgagagcgtgagggtgtcatcaccatcgaa
tcccaggtgcacccgcagagcccactctgtcccctgccaggctccgccttcactttgagc
actcccagcgccccaggtccgctggtgttcactgccctgagcccagactcgctgcagctg
agctgggagcggccacggaggcccaatggggatatcgtcggctacctggtgacctgtgag
atggcccaaggaggagggccagccactacattccgggtggatggcgacagccccgagagc
cggctgaccgtgccgggcctcagcgagaacgtgccctacaagttcaaggtgcaggccagg
accactgagggcttcgggccagagcgcgagggcatcatcaccatagagtcccaggatgga
ggccccttcccacagctgggcagccatgccgggctcttccagcacccactgcaaagtgag
tacagcagcatcaccaccacccacaccagcgccaccgagcccttcctagtggatgggctg
accctgggggcccagcacctggaggcaggcggctccctcacccggcatgtgacccaggag
tttgtgagccggacgctgaccaccagcggaaccctcagcacccaggtggaccaacagttc
ttccaaacctga

KEGG   Macaca mulatta (rhesus monkey): 707247
Entry
707247            CDS       T01028                                 

Gene name
ITGB8
Definition
(RefSeq) integrin beta-8 precursor
  KO
K06591  integrin beta 8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04514  Cell adhesion molecules
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    707247 (ITGB8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    707247 (ITGB8)
   04514 Cell adhesion molecules
    707247 (ITGB8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    707247 (ITGB8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    707247 (ITGB8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    707247 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    707247 (ITGB8)
   05414 Dilated cardiomyopathy
    707247 (ITGB8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    707247 (ITGB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    707247 (ITGB8)
   04515 Cell adhesion molecules [BR:mcc04515]
    707247 (ITGB8)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   707247 (ITGB8)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin beta subunits
   707247 (ITGB8)
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 707247
NCBI-ProteinID: NP_001252922
Ensembl: ENSMMUG00000006898
UniProt: H9FU34 G7MLQ3
LinkDB
Position
3
AA seq 769 aa
MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVLSLVLGLGQGEDNICASSNAASCARCLA
LGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTP
GEVSIQLRPGAEANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFF
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
TIAGEIESKAANLNNLVVEAYQKLISEVKVHVENQVQGVYFNITAICPDGSRKPGMEGCR
NVTSNHEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGK
CVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGK
VYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQV
CSGRGTCVCGRCECTDPRSIGRFCEHCPTCHTACKENWNCVQCLHPHNLSQAILDQCKTS
CALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSS
DYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgtgcggctcggccctggctttttttaccgctgcatttgtctgcctgcaaaacgaccgg
cgaggtcccgcctcgttcctctgggcagcctgggtactttcacttgttcttggactgggc
caaggtgaggacaatatatgtgcatcttcaaatgcagcatcctgtgccaggtgccttgcg
ctgggtccagaatgtggatggtgtgttcaagaggatttcatttcaggtggatcaagaagt
gaacgttgtgatattgtttccaatttaataagcaaaggctgctcagttgattcaatagaa
tacccatctgtgcatgttataatacccactgaaaatgaaattaatacccaggtgacacca
ggagaagtgtctatccaactgcgtccaggagctgaagctaattttatgctgaaaattcat
cctctgaagaaatatcctgtggatctttattatctggttgatgtctcagcatcaatgcac
aataatatagaaaaattaaattctgttggcaacgatttatctagaaaaatggcatttttc
tctcgtgactttcgccttggatttggttcatatgttgataaaacagtttcaccatacatt
agcatccaccctgaaaggattcataatcaatgcagtgactacaatttagactgcatgcct
ccccatggatacatccatgtgctgtctttgacagagaacatcactgagtttgagaaagca
gttcacagacagaagatctctggaaacatagatacaccggaaggaggttttgacgccatg
cttcaggcagctgtctgtgaaagtcatattggatggcgaaaagaggctaaaagattgctg
ctggtgatgacagatcagacatctcatcttgctcttgatagcaaattggcaggcatagtg
gtgcccaatgacggaaactgccatctgaaaaacaacgtctacgtcaaatcgacaaccatg
gaacatccctcactaggccaactttcagagaaattaatagacaacaacattaatgtcatc
tttgcagttcaaggaaaacaatttcattggtataaggatcttctacccctcttgccgggc
accattgctggtgaaatagaatcaaaggctgcaaacctcaataatttggtagtggaagcc
tatcagaagctcatttcagaagtgaaagttcatgtggaaaaccaggtacaaggtgtctat
tttaacattaccgccatctgtccagatgggtccagaaagccaggcatggagggatgcaga
aacgtgacaagcaaccatgaagttcttttcaatgtaacagttacaatgaaaaaatgtgat
gtcacaggaggaaaaaactatgcaataatcaaacctattggttttaatgaaaccgctaaa
attcatatacacagaaactgcagctgtcagtgtgaggacaacagaggacctaaaggaaag
tgtgtagatgaaacttttctagattccaagtgcttccagtgtgatgagaataaatgtcat
tttgatgaagatcagttttcttctgagagttgcaagtcacacaaggatcaacctgtttgc
agtggtcgaggagtttgtgtttgtgggaaatgttcatgtcacaaaattaagcttggaaaa
gtgtatggaaaatattgtgaaaaggatgacttttcttgtccatatcaccatggaaatctg
tgtgctgggcatggagagtgtgaagcaggcagatgccaatgcttcagtggctgggaggga
gatcggtgccagtgcccttcagcagcagcccagcactgtgtcaattcaaagggccaagtg
tgcagtggaagaggcacgtgtgtgtgtggaaggtgtgagtgcaccgatcccaggagcatc
ggccgcttctgtgaacactgccccacctgtcatacggcctgcaaggaaaactggaattgt
gtgcaatgccttcaccctcacaatttgtctcaggctatacttgatcagtgcaaaacctca
tgtgctctcatggaacaacagcattatgtcgaccaaacttcagaatgtttctccagccca
agctacttgagaatatttttcatcattttcatagttacattcttgattgggttgcttaaa
gtccttatcattagacaggtgatactacaatggaatagtaacaaaattaagtcctcgtca
gattacagagtgtcagcctcaaaaaaggataagttgattctgcaaagtgtttgcacaaga
gcagtaacctaccgacgtgagaagcctgaagaaataaaaatggatatcagcaaattaaat
gctcatgaaactttcaggtgcaacttctaa

KEGG   Macaca mulatta (rhesus monkey): 715710
Entry
715710            CDS       T01028                                 

Gene name
ITGB5
Definition
(RefSeq) integrin beta-5 precursor
  KO
K06588  integrin beta 5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05205  Proteoglycans in cancer
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    715710 (ITGB5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    715710 (ITGB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    715710 (ITGB5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    715710 (ITGB5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    715710 (ITGB5)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    715710 (ITGB5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    715710 (ITGB5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    715710 (ITGB5)
   05414 Dilated cardiomyopathy
    715710 (ITGB5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    715710 (ITGB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    715710 (ITGB5)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mcc04515]
    715710 (ITGB5)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    715710 (ITGB5)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin beta subunits
   715710 (ITGB5)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt PSI_integrin EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 715710
NCBI-ProteinID: NP_001253135
Ensembl: ENSMMUG00000014516
UniProt: H9ERG3
LinkDB
Position
2
AA seq 799 aa
MPRAPAPLYACLLGLCALLPGLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSI
TSRCDLRANLVRNGCGGEIESPASSFHILRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRP
GDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDTIRNLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
DGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD
TASFEVSVEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCSGSG
TYVCGLCECSPGYLGTRCECQDGENHSVYQNLCREAEGKPLCSGRGECSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGKDGQ
ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSL
CRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYTELPSGKSNLTVLREPECGNTPNA
MTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFTFNKFNKSYNGTVD
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgccgcgggccccggcgccgctgtacgcttgcctcctggggctctgcgcgctcctgccc
gggcttgcaggtctcaacatatgcactagtggaagtgccacttcatgtgaagaatgtctg
ctaatccacccaaaatgtgcctggtgctccaaagaggacttcggaagcccacggtccatc
acctctcggtgtgacttgagggccaaccttgtcagaaatggctgtggaggtgagatagag
agcccagccagcagcttccatatcctgaggagcctgcccctcagcagcaagggttcgggc
tctgcgggctgggacgtcattcagatgacaccacaggagattgctgtgaacctccggccc
ggtgacaagaccaccttccagctacaggttcgccaggtagaggactatcctgtggacctg
tactacctgatggacctctccctgtccatgaaggatgacttggacactatccggaacctg
ggcaccaaactcgcggaggagatgaggaagctcaccagcaacttccggttgggatttggg
tcttttgtcgataaggacatctctcctttctcctacacggcaccgaggtaccagaccaat
ccatgcattggttacaagttgtttccaaattgcgtcccctcctttgggttccgccatctg
ctgcctctcacagacagagtggacagcttcaatgaggaagttcggaagcagagggtgtcc
cggaaccgagatgcccctgaggggggctttgatgcagtactccaggcagccgtctgcaag
gagaagattggctggcgaaaggatgcactgcatttgctggtgttcacaacggatgatgtg
ccccatatcgcattggatggaaaattgggaggcctggtgcagccacatgatggccagtgc
cacctgaacgaggccaacgagtacactgcatccaaccagatggactatccatcccttgcc
ttgcttggagagaaattggcagagaacaacatcaacctcatcttcgcagtgacgaaaaac
cattatatgctgtacaagaattttacagccctgatacctggaacaacagtggagatttta
gatggagactccaaaaatattattcaactgattattaatgcatacaatagtatccggtct
aaagtggagctgtcagtctgggatcagcctgaagatcttaatctcttctttactgctacc
tgccaagatggggtatcctaccctggtcagaggaagtgtgagggcctgaagattggggac
acggcatcttttgaggtgtcagtggaggcccgaagctgccccagcagacacacagagcac
gtgtttgccctgcggccggtgggattccgggacagcctggaggtgggggtcacctacaac
tgcacgtgcggctgcagcgtggggctggaacccaacagcgccaggtgcagcgggagcggg
acctatgtctgcggcctgtgtgagtgcagccccggctacctgggcaccaggtgtgagtgc
caggatggggagaaccacagcgtgtaccagaacctgtgccgggaggcagagggcaagcca
ctgtgcagtgggcgcggggagtgcagctgcaaccagtgctcctgcttcgagagtgagttc
gggaagatctacgggcctttctgtgagtgcgacaacttctcctgtgccaggaacaaggga
gtcctctgctcaggccatggtgagtgtcactgcggggaatgcaagtgccatgcaggttac
atcggggacaactgtaactgctcgacagacatcagcacatgccggggcaaagatggccag
atctgcagtgagcgcgggcactgtctctgtgggcagtgccaatgcacggagccaggggcc
tttggggagatgtgtgagaagtgccccacctgcccggatgcgtgcagcaccaagagagat
tgcgtcgagtgcctgctgctccactccgggaaacctgacaaccagacctgccacagcctg
tgcagggacgaggtgatcacatgggtggacaccatcgtgaaagatgaccaggaggctgtg
ctttgcttctacaaaaccgccaaggactgcgtcatgatgttcacctacacggagctcccc
agtgggaagtccaacctgaccgtcctcagggagccagagtgtggaaacacccccaacgcc
atgaccatcctcctggctgtggtcggcagcatcctcctggttgggctcgcactcctggct
atctggaagctgctcgtcaccatccacgaccggagggagtttgcaaagttccagagcgag
cgatccagggcccgctatgaaatggcttcaaacccattgtacagaaagcccatctccacg
cacactgtggacttcaccttcaacaagttcaataaatcctacaatggcactgtggactga

KEGG   Macaca mulatta (rhesus monkey): 717379
Entry
717379            CDS       T01028                                 

Gene name
ITGB3
Definition
(RefSeq) integrin beta-3
  KO
K06493  integrin beta 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04810  Regulation of actin cytoskeleton
mcc04919  Thyroid hormone signaling pathway
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    717379 (ITGB3)
   04151 PI3K-Akt signaling pathway
    717379 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    717379 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    717379 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    717379 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    717379 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    717379 (ITGB3)
   04611 Platelet activation
    717379 (ITGB3)
   04613 Neutrophil extracellular trap formation
    717379 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    717379 (ITGB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    717379 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    717379 (ITGB3)
   05205 Proteoglycans in cancer
    717379 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    717379 (ITGB3)
   05410 Hypertrophic cardiomyopathy
    717379 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    717379 (ITGB3)
   05414 Dilated cardiomyopathy
    717379 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    717379 (ITGB3)
   05163 Human cytomegalovirus infection
    717379 (ITGB3)
   05165 Human papillomavirus infection
    717379 (ITGB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    717379 (ITGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    717379 (ITGB3)
   04515 Cell adhesion molecules [BR:mcc04515]
    717379 (ITGB3)
   04090 CD molecules [BR:mcc04090]
    717379 (ITGB3)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    717379 (ITGB3)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   717379 (ITGB3)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin beta subunits
   717379 (ITGB3)
CD molecules [BR:mcc04090]
 Proteins
  717379 (ITGB3)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 717379
NCBI-ProteinID: XP_014974842
Ensembl: ENSMMUG00000003289
UniProt: G7NJ66
LinkDB
Position
16
AA seq 788 aa
MRAQPGPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLSLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCNCACQAQAEPNSRHCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT
NT seq 2367 nt   +upstreamnt  +downstreamnt
atgcgagcgcagcccgggccccggccgctctgggcaactgtgctggcgctgggggcgctg
gcgggcgttggcgtcggagggcccaacatctgtaccacacgaggtgtgagctcctgccag
cagtgcctggctgtgagccccatgtgtgcctggtgctctgatgaggccctgcctctgggc
tcacctcgctgtgacctgaaggagaatctgctgaaggataactgtgccccggaatccatc
gagttcccagtcagtgaggcccgagtactagaggacaggcccctcagcgacaaaggctct
ggagacagctcccaggtcactcaagtcagtccccagaggattgcactccggctccggcca
gatgattcgaagaatttctccatccaagtgcggcaggtggaggattaccctgtggacatc
tactacttgatggacctgtcttactccatgaaggacgatctgtggagcatccagaacctg
ggtaccaagctggccacccagatgcgaaagctcaccagtaacctgcggattggcttcggg
gcatttgtggacaagcctgtgtcaccatacatgtatatctccccaccagaggccctcgaa
aacccctgctatgatatgaagaccacctgcttgcccatgtttggctacaaacacgtgctg
tcgctaactgaccaggtgacccgcttcaatgaggaagtgaagaagcagagtgtgtcacgg
aaccgagatgccccagagggtggctttgatgccatcatgcaggctacagtctgtgatgaa
aagattggctggaggaatgatgcttcgcacttgctggtgtttaccactgatgccaagact
catatagcactggacggaaggctggcaggcattgtccagcccaatgatgggcagtgtcat
gttggtagtgacaatcattactctgcctccactaccatggattatccctctttggggctg
atgactgagaagctctcccagaaaaacatcaatttgatctttgcagtgactgaaaatgta
gtcaatctctatcagaactatagtgagctcatcccagggaccacagtcggggttctgtcc
atggattccagcaatgtcctccagctcattgttgatgcttatgggaaaatccgctctaaa
gtcgagctggaagtgcgtgacctccctgaagaattgtctctatccttcaacgccacctgc
ctcaacaatgaggtcatccctggcctcaagtcttgtatgggactcaagattggagacacg
gtgagcttcagcattgaggccaaggtgcgaggctgcccccaggagaaggagaagtccttt
accatcaagcccgtgggcttcaaggacagcctgatcgtccaggtcacctttgattgcaac
tgtgcctgccaggcccaagctgaacctaatagccgtcactgcaacaatggcaatgggacc
tttgagtgtggggtgtgccgttgtgggcctggctggctgggatcccagtgtgagtgctca
gaggaggactatcgcccttcccagcaggacgagtgcagcccccgggagggtcagcccgtc
tgcagccagcggggcgagtgtctctgtggtcaatgtgtctgccacagcagtgactttggc
aagatcacgggcaagtactgcgagtgtgatgacttctcctgtgtccgctacaagggggag
atgtgctcaggccatggccagtgcagctgtggggactgcctgtgtgactccgactggacc
ggctactactgcaactgcaccacacgtactgatacctgcatgtccagcaatgggctgctg
tgcagcggccgcggcaagtgtgaatgtggcagctgtgtctgtatccagccgggctcctat
ggggacacctgtgagaagtgccctacctgcccagatgcctgcacctttaagaaagaatgc
gtagagtgtaagaagtttgaccggggagccctacatgatgaaaatacctgcaaccgttac
tgccgcgatgagattgagtcagtgaaagagcttaaggacactggcaaggatgcagtgaat
tgtacctataagaatgaggatgactgtgtcgtcagattccagtactatgaagactctagt
ggaaagtccatcctgtatgtggtagaagagccagagtgtcccaagggccctgacatcctg
gtggtcctgctgtcagtgatgggggccattctgctcatcggccttgccactctgctcatc
tggaagctcctcatcaccatccacgaccgaaaagagtttgctaaatttgaggaagaacgc
gccagagcaaaatgggacacagccaacaacccactgtataaagaggccacgtctaccttc
accaatatcacctaccggggcacttaa

DBGET integrated database retrieval system