KEGG   Macaca mulatta (rhesus monkey): 574320
Entry
574320            CDS       T01028                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04068  FoxO signaling pathway
mcc04110  Cell cycle
mcc04115  p53 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04218  Cellular senescence
mcc04310  Wnt signaling pathway
mcc04340  Hedgehog signaling pathway
mcc04371  Apelin signaling pathway
mcc04390  Hippo signaling pathway
mcc04510  Focal adhesion
mcc04530  Tight junction
mcc04630  JAK-STAT signaling pathway
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04934  Cushing syndrome
mcc05160  Hepatitis C
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05216  Thyroid cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    574320 (CCND1)
   04340 Hedgehog signaling pathway
    574320 (CCND1)
   04390 Hippo signaling pathway
    574320 (CCND1)
   04371 Apelin signaling pathway
    574320 (CCND1)
   04630 JAK-STAT signaling pathway
    574320 (CCND1)
   04068 FoxO signaling pathway
    574320 (CCND1)
   04151 PI3K-Akt signaling pathway
    574320 (CCND1)
   04152 AMPK signaling pathway
    574320 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    574320 (CCND1)
   04115 p53 signaling pathway
    574320 (CCND1)
   04218 Cellular senescence
    574320 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    574320 (CCND1)
   04530 Tight junction
    574320 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    574320 (CCND1)
   04921 Oxytocin signaling pathway
    574320 (CCND1)
   04919 Thyroid hormone signaling pathway
    574320 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574320 (CCND1)
   05206 MicroRNAs in cancer
    574320 (CCND1)
   05205 Proteoglycans in cancer
    574320 (CCND1)
   05203 Viral carcinogenesis
    574320 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    574320 (CCND1)
   05212 Pancreatic cancer
    574320 (CCND1)
   05225 Hepatocellular carcinoma
    574320 (CCND1)
   05226 Gastric cancer
    574320 (CCND1)
   05214 Glioma
    574320 (CCND1)
   05216 Thyroid cancer
    574320 (CCND1)
   05221 Acute myeloid leukemia
    574320 (CCND1)
   05220 Chronic myeloid leukemia
    574320 (CCND1)
   05218 Melanoma
    574320 (CCND1)
   05219 Bladder cancer
    574320 (CCND1)
   05215 Prostate cancer
    574320 (CCND1)
   05213 Endometrial cancer
    574320 (CCND1)
   05224 Breast cancer
    574320 (CCND1)
   05222 Small cell lung cancer
    574320 (CCND1)
   05223 Non-small cell lung cancer
    574320 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    574320 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    574320 (CCND1)
   04934 Cushing syndrome
    574320 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    574320 (CCND1)
   05162 Measles
    574320 (CCND1)
   05160 Hepatitis C
    574320 (CCND1)
   05163 Human cytomegalovirus infection
    574320 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    574320 (CCND1)
   05169 Epstein-Barr virus infection
    574320 (CCND1)
   05165 Human papillomavirus infection
    574320 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    574320 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 574320
NCBI-ProteinID: NP_001265375
Ensembl: ENSMMUG00000002368
UniProt: H9FY18
LinkDB
Position
14
AA seq 295 aa
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLGSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggaaaccatccgccgcgcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctgaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaaatgtgtgcagaaggaggtcctcccgtccatgcggaagatcgtc
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctctaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacaccgacaactccatccggcccgaagagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggccgccatgaccccgcacgatttc
atcgaacacttcctttccaaaatgccagaggcggaggagaacaaacagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaatccaccc
tccatggtggcagcagggagcgtggtggccgcagtgcaaggcctgaacctggggagcccc
aacaacttcctgtcctactaccgcctcacacgcttcctctccagagtgatcaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtcaagcctgcgc
caggcccagcagaacatggaccccaaggccgccgaggaggaggaagaggaggaggaggag
gtggacctggcttgcacacccaccgacgtgcgggatgtggacatctga

DBGET integrated database retrieval system