KEGG   Macaca mulatta (rhesus monkey): 574332
Entry
574332            CDS       T01028                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6 precursor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01524  Platinum drug resistance
mcc04010  MAPK signaling pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04115  p53 signaling pathway
mcc04210  Apoptosis
mcc04217  Necroptosis
mcc04650  Natural killer cell mediated cytotoxicity
mcc04668  TNF signaling pathway
mcc04932  Non-alcoholic fatty liver disease
mcc04940  Type I diabetes mellitus
mcc05010  Alzheimer disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    574332 (FAS)
   04668 TNF signaling pathway
    574332 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574332 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    574332 (FAS)
   04217 Necroptosis
    574332 (FAS)
   04115 p53 signaling pathway
    574332 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    574332 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574332 (FAS)
   05205 Proteoglycans in cancer
    574332 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    574332 (FAS)
   05330 Allograft rejection
    574332 (FAS)
   05332 Graft-versus-host disease
    574332 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    574332 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    574332 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    574332 (FAS)
   04932 Non-alcoholic fatty liver disease
    574332 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    574332 (FAS)
   05161 Hepatitis B
    574332 (FAS)
   05160 Hepatitis C
    574332 (FAS)
   05164 Influenza A
    574332 (FAS)
   05162 Measles
    574332 (FAS)
   05168 Herpes simplex virus 1 infection
    574332 (FAS)
   05163 Human cytomegalovirus infection
    574332 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    574332 (FAS)
   05169 Epstein-Barr virus infection
    574332 (FAS)
   05165 Human papillomavirus infection
    574332 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    574332 (FAS)
   05143 African trypanosomiasis
    574332 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    574332 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    574332 (FAS)
   04090 CD molecules [BR:mcc04090]
    574332 (FAS)
Cytokine receptors [BR:mcc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   574332 (FAS)
CD molecules [BR:mcc04090]
 Proteins
  574332 (FAS)
SSDB
Motif
Pfam: TNFR_c6 Death Peptidase_C8 Stn1_C TMEM154
Other DBs
NCBI-GeneID: 574332
NCBI-ProteinID: NP_001028105
Ensembl: ENSMMUG00000011186
UniProt: Q9BDP2
LinkDB
Position
9
AA seq 333 aa
MLGIWTLLPLVLTSVVRLLSKCVNAQVTDISSKGFELRKIVTTIETQNLEGLHHEGQFCR
NPCPPGERKARDCTVNEDEPDCVPCQEGEEYTDKGHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKCRCKPNFFCNSAVCEHCDPCTKCKHGIIEECTLTSNTKCKEEDSRSDLLWLCLL
LLLLLIPPIVYVVIKEPCRKRRKENQGPHESTTLNPETAINLSDVDLSKYITTIAGAMTL
SQVKDFVRKNGVSEAKIDEIKNDNVQDTAEQKVQLLRNWYQLHGKKDACDTLIKGLKTAD
LCTLAEKIHAVILKDITSDTENSNFGNEVQNLV
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgctgggcatctggaccctcctacctctggttcttacctctgttgttagattattgtcc
aaatgtgttaatgcccaagtgactgatatcagctccaagggatttgaattgaggaagatc
gttactacaattgagactcagaacttggaaggcctgcatcacgagggccaattctgccgt
aacccctgtcctccaggtgaaaggaaagctagggactgcacagtcaatgaggatgaacca
gactgcgtgccctgccaagaaggggaggagtacacagacaaaggccatttttcttccaaa
tgcagaagatgtagattgtgtgatgaaggacatggcttagaagtggaaataaactgcacc
cggacccagaataccaagtgcagatgtaaaccaaactttttttgtaactctgctgtatgt
gaacactgtgacccttgcaccaagtgtaaacatggaatcatcgaggaatgcacactcacc
agcaacaccaagtgcaaagaggaagattccagatctgatttgctgtggttatgtcttctt
cttcttcttctcctaattccaccaattgtttatgtggtgataaaggaaccatgcagaaag
cgcagaaaggaaaaccaaggtcctcatgaatctacaaccttaaatcctgaaacagcaata
aatttatctgatgttgacttgagtaaatatatcaccactatcgctggagccatgacacta
agtcaagttaaagactttgttcgaaagaatggtgtcagtgaagccaaaatagatgagatc
aagaatgacaatgtccaagacacagcagaacaaaaagttcaactgcttcgtaattggtat
caacttcatggaaagaaagatgcatgtgacacattgattaaaggtctaaaaacagctgat
ctttgtactcttgcagagaaaattcacgctgtcatcctcaaggacattactagtgacaca
gaaaattcgaacttcggaaatgaagtccaaaacttggtctag

DBGET integrated database retrieval system