KEGG   Macaca mulatta (rhesus monkey): 574334
Entry
574334            CDS       T01028                                 

Gene name
CXCL12
Definition
(RefSeq) stromal cell-derived factor 1 precursor
  KO
K10031  C-X-C motif chemokine 12
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04062  Chemokine signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04360  Axon guidance
mcc04670  Leukocyte transendothelial migration
mcc04672  Intestinal immune network for IgA production
mcc04810  Regulation of actin cytoskeleton
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
mcc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    574334 (CXCL12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574334 (CXCL12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    574334 (CXCL12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    574334 (CXCL12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    574334 (CXCL12)
   04672 Intestinal immune network for IgA production
    574334 (CXCL12)
   04062 Chemokine signaling pathway
    574334 (CXCL12)
  09158 Development and regeneration
   04360 Axon guidance
    574334 (CXCL12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574334 (CXCL12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    574334 (CXCL12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    574334 (CXCL12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    574334 (CXCL12)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    574334 (CXCL12)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Chemokines
   574334 (CXCL12)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Chemokines
   574334 (CXCL12)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 574334
NCBI-ProteinID: NP_001028106
UniProt: Q8HYP0
LinkDB
Position
9
AA seq 89 aa
MNAKVVVVLALVLTTLCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNK
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaacgccaaggtcgtggtcgtgctggccctcgtgctgaccacgctctgcctcagcgac
gggaagcccgtcagcctgagctacagatgcccatgccgattcttcgaaagccatgttgcc
agagccaacgtcaagcatctcaaaattctcaacactccgaactgtgcccttcagattgta
gctcggctgaagaacaacaacagacaagtgtgcattgacccgaagctaaagtggattcag
gagtacctggagaaagctttaaacaagtaa

DBGET integrated database retrieval system