KEGG   Macaca mulatta (rhesus monkey): 574352
Entry
574352            CDS       T01028                                 

Gene name
PRKCI
Definition
(RefSeq) protein kinase C iota type isoform X1
  KO
K06069  atypical protein kinase C iota type [EC:2.7.11.13]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04144  Endocytosis
mcc04390  Hippo signaling pathway
mcc04530  Tight junction
mcc04611  Platelet activation
mcc04910  Insulin signaling pathway
mcc05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    574352 (PRKCI)
   04390 Hippo signaling pathway
    574352 (PRKCI)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    574352 (PRKCI)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    574352 (PRKCI)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    574352 (PRKCI)
  09152 Endocrine system
   04910 Insulin signaling pathway
    574352 (PRKCI)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    574352 (PRKCI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    574352 (PRKCI)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     574352 (PRKCI)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   574352 (PRKCI)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 C1_1 Pkinase_C Kinase-like Kdo APH C1_2
Other DBs
NCBI-GeneID: 574352
NCBI-ProteinID: XP_014987118
Ensembl: ENSMMUG00000011222
UniProt: A0A5F7ZX99
LinkDB
Position
2
AA seq 690 aa
MWAFGASEVGGTDAGGVLGPGGCRGGGAYGEWEEPRGSGCSGEATLGSALRARWAGRWAD
GRGSPTGAGGGVPHGVRSAPPHPRPPVLRRGSEEMPTQRDSSTMSHTVAGGGSGDHSHQV
RVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLEL
EEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAK
RFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPPEPVMPMDQS
SMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGSYA
KVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTES
RLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLL
DSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEM
MAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLG
CHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPD
DDDIVRKIDQSEFEGFEYINPLLMSAEECV
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgtgggcctttggagcgagcgaagtgggagggaccgacgcaggaggtgtcctgggcccg
ggcggctgtagaggcggcggcgcctacggggagtgggaggagccgcgcggttccggctgc
tccggcgaggcgacccttgggtcggcgctgcgggcgaggtgggcaggtaggtgggctgac
ggccgcggctctccgacaggcgcgggcggcggagtcccccacggggtccggagcgccccc
ccgcacccccggcctccagtgttgaggcgggggagtgaggagatgccgactcagagggac
agcagcaccatgtcccacacggtcgcaggcggcggcagcggggaccattcccaccaggtc
cgggtgaaagcctactaccgcggggatatcatgataacacattttgaaccttccatctcc
tttgagggcctttgcaatgaggttcgagacatgtgttcttttgacaacgaacagctcttc
accatgaaatggatagatgaagaaggagacccatgtaccgtatcatctcagttggagtta
gaagaagcctttagactttatgagctaaacaaggattctgaactcttgattcatgtgttc
ccttgtgtaccagaacgtcctgggatgccttgtccaggagaagataaatccatctaccgt
agaggtgcacgccgctggagaaagctttattgtgccaatggccacactttccaagccaag
cgtttcaacaggcgtgctcactgtgccatctgcacagaccgaatatggggacttggacgc
caaggatataagtgcatcaactgcaaactcttggttcataagaagtgccataaactcgtc
acaattgaatgtgggcggcattctttgccaccggaaccagtgatgcccatggatcagtca
tccatgcattctgaccatgcacagacagtaattccatacaatccttcaagtcatgagagt
ttggatcaagttggtgaagaaaaagaggcaatgaacaccagggaaagtggcaaagcttca
tccagtttaggtctccaggattttgatttgctgcgggtaataggaagaggaagttatgcc
aaagtactattggttcgattaaaaaaaacagatcgtatttatgcaatgaaagttgtgaaa
aaagagcttgttaatgatgatgaggatattgattgggtacagacagagaagcatgtgttt
gagcaggcatccaatcatcctttccttgttgggctacattcttgctttcagacagaaagc
agattgttctttgttatagagtatgtaaatggaggagacctaatgtttcatatgcagcga
caaagaaaacttcctgaagaacatgccagattttactctgcagaaatcagtctagcatta
aattatcttcatgagcgagggataatttatagagatttgaaactggacaatgtattactg
gactctgaaggccacattaaactcactgactacggcatgtgtaaggaaggattacggcca
ggagatacaaccagcactttctgtggtactcctaattacattgctcctgaaattttaaga
ggagaagattatggtttcagtgttgactggtgggctcttggagtgctgatgtttgagatg
atggcaggaaggtctccatttgatattgttgggagctccgataaccctgaccagaacaca
gaggattatctcttccaagttattttggaaaaacaaattcgcataccacgttctctctct
gtaaaagctgcaagtgttctgaagagttttcttaacaaggaccctaaggaacgattgggt
tgtcatcctcaaacaggatttgctgatattcagggacacccgttcttccgaaatgttgat
tgggatatgatggagcaaaaacaggtggtacctccctttaaaccaaatatttctggggaa
tttggtttggacaactttgattctcagtttaccaatgaacctgtccagctcactccagat
gacgatgacattgtgaggaagattgatcagtctgaatttgaaggttttgagtatatcaat
cctcttttgatgtctgcagaagaatgtgtctga

KEGG   Macaca mulatta (rhesus monkey): 710340
Entry
710340            CDS       T01028                                 

Gene name
PRKCZ
Definition
(RefSeq) protein kinase C zeta type isoform X1
  KO
K18952  atypical protein kinase C zeta type [EC:2.7.11.13]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04062  Chemokine signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04144  Endocytosis
mcc04360  Axon guidance
mcc04390  Hippo signaling pathway
mcc04530  Tight junction
mcc04611  Platelet activation
mcc04910  Insulin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05165  Human papillomavirus infection
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    710340 (PRKCZ)
   04390 Hippo signaling pathway
    710340 (PRKCZ)
   04071 Sphingolipid signaling pathway
    710340 (PRKCZ)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    710340 (PRKCZ)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    710340 (PRKCZ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    710340 (PRKCZ)
   04062 Chemokine signaling pathway
    710340 (PRKCZ)
  09152 Endocrine system
   04910 Insulin signaling pathway
    710340 (PRKCZ)
   04926 Relaxin signaling pathway
    710340 (PRKCZ)
  09158 Development and regeneration
   04360 Axon guidance
    710340 (PRKCZ)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    710340 (PRKCZ)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    710340 (PRKCZ)
   04931 Insulin resistance
    710340 (PRKCZ)
   04933 AGE-RAGE signaling pathway in diabetic complications
    710340 (PRKCZ)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    710340 (PRKCZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    710340 (PRKCZ)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     710340 (PRKCZ)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   710340 (PRKCZ)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 C1_1 Pkinase_C Kinase-like C1_2 APH Kdo
Other DBs
NCBI-GeneID: 710340
NCBI-ProteinID: XP_014989210
UniProt: F6ZZK4
LinkDB
Position
1
AA seq 592 aa
MPSRTSPKMDGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKW
VDSEGDPCTVSSQMELEEAFRLARQRRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGAR
RWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTC
RKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDG
IKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI
CIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF
LSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQIT
DDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgcccagcaggaccagccccaagatggacgggagcggcggccgcgtccgcctcaaggcg
cattacggaggggacatcttcatcaccagcgtggacgccgccacaaccttcgaggagctc
tgcgaggaagtgagagacatgtgccgtctgcaccagcagcacccgctcaccctcaagtgg
gtggacagcgaaggtgacccttgcacggtgtcctcccagatggagctggaagaggctttc
cgcctggcccgtcagcgcagggacgaaggcctcatcattcatgttttcccgagcacccct
gagcagccaggactgccgtgtccaggagaagacaaatccatctaccgccggggagccaga
agatggaggaagctgtaccgtgccaacggccatctcttccaagccaagcgctttaacagg
agagcgtactgcggtcagtgcagcgagaggatatggggcctcgcgaggcaaggctacagg
tgcatcaactgcaaactgctggtccataagcgctgccacggcctcgtcccgctgacctgc
aggaagcatatggattctgtcatgccttcccaagagcctccagtagatgacaagaacgag
gacgccgaccttccttccgaggagacagatggaattgcttacatttcctcatcccggaaa
catgacagcattaaagacgactctgaggaccttaagccagttatcgatgggatggatgga
atcaaaatctctcaggggctcgggctgcaggacttcgacctaatcagagtcatagggcgc
gggagctacgccaaggttctcctggtgcggttgaagaagaatgaccaaatttacgccatg
aaagtggtgaagaaagagctggtgcatgacgacgaggatattgactgggtacagacagag
aagcacgtgtttgagcaggcatccagcaaccccttcctggtcggattacattcctgcttc
cagacgacaagtcggctgttcctggtcattgagtacgtcaatggcggggacctgatgttc
cacatgcagaggcagaggaagctccccgaggagcacgccaggttctacgcggccgagatc
tgcatcgccctcaacttcctacacgagagggggatcatctaccgggacctgaagctggac
aacgtcctcctggacgcggacgggcacatcaagctcacagactacggcatgtgcaaggaa
ggcctgggccctggcgacacaacaagcactttctgcggaaccccgaactacatcgccccc
gaaatcctgcggggagaagagtacgggttcagcgtggactggtgggcactgggcgtcctc
atgtttgagatgatggccgggcgctccccatttgacatcatcaccgacaacccggacatg
aacacagaggactaccttttccaagtgatcctggagaagcccatccggatcccccggttc
ctgtccgtcaaagcctcccatgttttaaaaggatttttaaataaggaccccaaagagagg
ctcggctgccggccacagactggattttcagacatcaagtcccacgcgttcttccgcagc
atagactgggacttgctggagaagaagcaggcgctccctccattccagccacagatcacg
gacgactacggtctggacaactttgacacacagttcaccagcgagcccgtgcagctgacc
ccagacgatgaggatgccataaagaggatcgaccagtcggagttcgaaggcttcgagtac
atcaacccattactgctgtccaccgaggagtcggtgtga

DBGET integrated database retrieval system