KEGG   Macaca mulatta (rhesus monkey): 574394
Entry
574394            CDS       T01028                                 

Gene name
GNAO1
Definition
(RefSeq) guanine nucleotide-binding protein G(o) subunit alpha
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04713  Circadian entrainment
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04727  GABAergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04921  Oxytocin signaling pathway
mcc04926  Relaxin signaling pathway
mcc05032  Morphine addiction
mcc05034  Alcoholism
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05163  Human cytomegalovirus infection
mcc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    574394 (GNAO1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    574394 (GNAO1)
   04921 Oxytocin signaling pathway
    574394 (GNAO1)
   04926 Relaxin signaling pathway
    574394 (GNAO1)
   04916 Melanogenesis
    574394 (GNAO1)
  09156 Nervous system
   04724 Glutamatergic synapse
    574394 (GNAO1)
   04727 GABAergic synapse
    574394 (GNAO1)
   04725 Cholinergic synapse
    574394 (GNAO1)
   04728 Dopaminergic synapse
    574394 (GNAO1)
   04726 Serotonergic synapse
    574394 (GNAO1)
   04730 Long-term depression
    574394 (GNAO1)
   04723 Retrograde endocannabinoid signaling
    574394 (GNAO1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    574394 (GNAO1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    574394 (GNAO1)
   05034 Alcoholism
    574394 (GNAO1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    574394 (GNAO1)
   05163 Human cytomegalovirus infection
    574394 (GNAO1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    574394 (GNAO1)
   05142 Chagas disease
    574394 (GNAO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    574394 (GNAO1)
   04031 GTP-binding proteins [BR:mcc04031]
    574394 (GNAO1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   574394 (GNAO1)
GTP-binding proteins [BR:mcc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    574394 (GNAO1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB DUF685 AAA_29 AAA_24
Other DBs
NCBI-GeneID: 574394
NCBI-ProteinID: NP_001182358
Ensembl: ENSMMUG00000019900
UniProt: F7GQC5
LinkDB
Position
20
AA seq 354 aa
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDA
AAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggatgtactctgagcgcagaggagagagccgccctcgagcggagcaaggcgattgag
aaaaacctcaaagaggatggcatcagcgccgccaaagacgtgaaattactcctgctgggg
gctggagaatcaggaaaaagcaccattgtgaagcagatgaagatcatccatgaagatggc
ttctccggagaagacgtgaaacagtacaagcctgttgtctacagcaacaccatccagtcc
ctggcagccatcgtccgggccatggacactttgggcatcgaatatggtgataaggagaga
aaggctgacgccaagatggtgtgcgacgtggtgagtcggatggaagacaccgagcccttc
tctgcagagctgctttctgccatgatgcggctctggggcgactcaggaatccaagagtgc
ttcaaccggtcccgggagtatcagctcaacgactctgccaaatactacctggacagcctg
gatcggattggggccgccgactaccagcccaccgagcaggacatcctccgaaccagggtc
aaaaccactggcatcgtagaaacgcacttcacattcaagaacctccacttcaggctgttt
gacgtcggaggccagcgatctgaacgcaagaagtggatccattgcttcgaggacgtcacg
gccatcattttctgtgtcgcgctcagcggctatgaccaggtgctccacgaagacgaaacc
acgaaccgcatgcacgagtctctcatgctcttcgactccatctgtaacaacaagttcttc
atcgatacctccatcattctcttcctcaacaagaaagatctatttggcgagaagatcaag
aagtcgcctttgaccatctgctttcctgaatacacaggccccaatacctatgaagatgca
gccgcctacatccaagcacaatttgaaagcaaaaaccgctcacccaacaaagaaatatat
tgtcacatgacttgtgccacagacacgaataatatccaggtggtgttcgacgccgtcacc
gacatcatcattgccaacaacctccggggctgcggcttgtactga

KEGG   Macaca mulatta (rhesus monkey): 699310
Entry
699310            CDS       T01028                                 

Gene name
GNAI3
Definition
(RefSeq) guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04360  Axon guidance
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04670  Leukocyte transendothelial migration
mcc04713  Circadian entrainment
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04727  GABAergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04924  Renin secretion
mcc04926  Relaxin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04971  Gastric acid secretion
mcc05012  Parkinson disease
mcc05030  Cocaine addiction
mcc05032  Morphine addiction
mcc05034  Alcoholism
mcc05133  Pertussis
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05163  Human cytomegalovirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    699310 (GNAI3)
   04371 Apelin signaling pathway
    699310 (GNAI3)
   04071 Sphingolipid signaling pathway
    699310 (GNAI3)
   04024 cAMP signaling pathway
    699310 (GNAI3)
   04022 cGMP-PKG signaling pathway
    699310 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    699310 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    699310 (GNAI3)
   04670 Leukocyte transendothelial migration
    699310 (GNAI3)
   04062 Chemokine signaling pathway
    699310 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    699310 (GNAI3)
   04915 Estrogen signaling pathway
    699310 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    699310 (GNAI3)
   04921 Oxytocin signaling pathway
    699310 (GNAI3)
   04926 Relaxin signaling pathway
    699310 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    699310 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    699310 (GNAI3)
   04916 Melanogenesis
    699310 (GNAI3)
   04924 Renin secretion
    699310 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    699310 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    699310 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    699310 (GNAI3)
   04727 GABAergic synapse
    699310 (GNAI3)
   04725 Cholinergic synapse
    699310 (GNAI3)
   04728 Dopaminergic synapse
    699310 (GNAI3)
   04726 Serotonergic synapse
    699310 (GNAI3)
   04730 Long-term depression
    699310 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    699310 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    699310 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    699310 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    699310 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    699310 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    699310 (GNAI3)
   05032 Morphine addiction
    699310 (GNAI3)
   05034 Alcoholism
    699310 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    699310 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    699310 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    699310 (GNAI3)
   05163 Human cytomegalovirus infection
    699310 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    699310 (GNAI3)
   05142 Chagas disease
    699310 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    699310 (GNAI3)
   04031 GTP-binding proteins [BR:mcc04031]
    699310 (GNAI3)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   699310 (GNAI3)
GTP-binding proteins [BR:mcc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    699310 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 699310
NCBI-ProteinID: NP_001252902
Ensembl: ENSMMUG00000005818
UniProt: F6VL43 G7MIE3
LinkDB
Position
1
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaagacaaggcggcagtggagcgaagcaagatgatcgac
cgcaacttacgggaggacggggaaaaagcggccaaagaagtgaagctgctgctactcggt
gctggagaatctggtaaaagcaccattgtgaaacagatgaaaatcattcatgaggatggc
tattcagaggatgaatgtaaacaatataaagtagttgtctacagcaatactatacagtcc
atcattgcaatcataagagccatgggacggctaaagattgactttggggaagctgccagg
gcagatgatgcccgacaattatttgttttagctggcagtgctgaagaaggagtcatgact
ccagaactagcaggagtgattaaacggttatggcgagatggtggggtacaagcttgcttc
agcagatccagggaatatcagctcaatgattctgcttcatattatctaaatgatctggat
agaatatcccagtctaactacattccaactcagcaagatgttcttcggacgagagtgaag
accacaggcattgtagaaacgcatttcaccttcaaagacctatacttcaagatgtttgat
gtaggtggccaaagatcagaacgaaaaaagtggattcactgttttgagggagtgacagca
attattttctgtgtggccctcagtgattatgaccttgttctggctgaggacgaggagatg
aaccgaatgcatgaaagcatgaaactgtttgacagcatttgtaataacaaatggtttaca
gaaacttcaatcattctctttcttaacaagaaagacctgtttgaggaaaaaataaagagg
agtccgttaactatctgttatccagaatacacaggttccaatacatatgaagaggcagct
gcctatattcaatgccagtttgaagatctgaacagaagaaaagataccaaggagatctac
actcacttcacctgtgccacagacacgaagaatgtgcagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtggactttattga

KEGG   Macaca mulatta (rhesus monkey): 703780
Entry
703780            CDS       T01028                                 

Gene name
GNAI2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04360  Axon guidance
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04670  Leukocyte transendothelial migration
mcc04713  Circadian entrainment
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04727  GABAergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04924  Renin secretion
mcc04926  Relaxin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04971  Gastric acid secretion
mcc05012  Parkinson disease
mcc05030  Cocaine addiction
mcc05032  Morphine addiction
mcc05034  Alcoholism
mcc05133  Pertussis
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05163  Human cytomegalovirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    703780 (GNAI2)
   04371 Apelin signaling pathway
    703780 (GNAI2)
   04071 Sphingolipid signaling pathway
    703780 (GNAI2)
   04024 cAMP signaling pathway
    703780 (GNAI2)
   04022 cGMP-PKG signaling pathway
    703780 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    703780 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    703780 (GNAI2)
   04670 Leukocyte transendothelial migration
    703780 (GNAI2)
   04062 Chemokine signaling pathway
    703780 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    703780 (GNAI2)
   04915 Estrogen signaling pathway
    703780 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    703780 (GNAI2)
   04921 Oxytocin signaling pathway
    703780 (GNAI2)
   04926 Relaxin signaling pathway
    703780 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    703780 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    703780 (GNAI2)
   04916 Melanogenesis
    703780 (GNAI2)
   04924 Renin secretion
    703780 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    703780 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    703780 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    703780 (GNAI2)
   04727 GABAergic synapse
    703780 (GNAI2)
   04725 Cholinergic synapse
    703780 (GNAI2)
   04728 Dopaminergic synapse
    703780 (GNAI2)
   04726 Serotonergic synapse
    703780 (GNAI2)
   04730 Long-term depression
    703780 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    703780 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    703780 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    703780 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    703780 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    703780 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    703780 (GNAI2)
   05032 Morphine addiction
    703780 (GNAI2)
   05034 Alcoholism
    703780 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    703780 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    703780 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    703780 (GNAI2)
   05163 Human cytomegalovirus infection
    703780 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    703780 (GNAI2)
   05142 Chagas disease
    703780 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    703780 (GNAI2)
   04031 GTP-binding proteins [BR:mcc04031]
    703780 (GNAI2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   703780 (GNAI2)
GTP-binding proteins [BR:mcc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    703780 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29
Other DBs
NCBI-GeneID: 703780
NCBI-ProteinID: NP_001245036
Ensembl: ENSMMUG00000020116
UniProt: I0FJU1 G7ML73
LinkDB
Position
2
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcacagtgagcgccgaggacaaggcggcggccgagcgctctaagatgatcgac
aagaacctgcgggaggacggagagaaggcggcgcgggaggtgaagttgctgctgttgggt
gctggggagtcagggaagagcaccatcgtcaagcagatgaagatcatccacgaggatggc
tactccgaggaggaatgccggcagtaccgggcggttgtttacagcaacaccatccagtcc
atcatggccattgtcaaagccatgggcaacctgcagatcgactttgccgacccctccaga
gcggacgacgccaggcagctatttgcactgtcctgcaccgctgaggagcaaggcgtgctc
cccgatgacctgtccggcgtcatccggaggctctgggctgaccatggtgtgcaggcctgc
tttggccgctcaagggaataccagctcaacgactcagccgcctactacctgaacgacctg
gagcgcattgcacagagtgactacatccccacgcagcaagatgtgttacggacccgcgta
aagaccacggggatcgtggagacacacttcaccttcaaggacctacacttcaagatgttt
gatgtgggtggtcagcggtctgagcggaagaagtggatccactgctttgagggcgtcaca
gccatcatcttctgcgtagccttgagcgcctacgacttggtgctagctgaggacgaggag
atgaaccgcatgcatgagagcatgaagctattcgacagcatctgcaacaacaagtggttc
acagacacgtccatcatcctcttcctcaacaagaaggacctgttcgaggagaagatcaca
cacagtcccctgaccatctgcttccctgagtacacaggggccaacaagtatgatgaggca
gccagctacatccagagtaagtttgaggacctgaataagcgcaaagacaccaaggagatc
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagttcgtgtttgacgccgtc
accgatgtcatcatcaagaacaacctgaaggactgcggcctcttctga

KEGG   Macaca mulatta (rhesus monkey): 708940
Entry
708940            CDS       T01028                                 

Gene name
GNAI1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1 isoform X1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04360  Axon guidance
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04670  Leukocyte transendothelial migration
mcc04713  Circadian entrainment
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04727  GABAergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04924  Renin secretion
mcc04926  Relaxin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04971  Gastric acid secretion
mcc05012  Parkinson disease
mcc05030  Cocaine addiction
mcc05032  Morphine addiction
mcc05034  Alcoholism
mcc05133  Pertussis
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05163  Human cytomegalovirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    708940 (GNAI1)
   04371 Apelin signaling pathway
    708940 (GNAI1)
   04071 Sphingolipid signaling pathway
    708940 (GNAI1)
   04024 cAMP signaling pathway
    708940 (GNAI1)
   04022 cGMP-PKG signaling pathway
    708940 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    708940 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    708940 (GNAI1)
   04670 Leukocyte transendothelial migration
    708940 (GNAI1)
   04062 Chemokine signaling pathway
    708940 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    708940 (GNAI1)
   04915 Estrogen signaling pathway
    708940 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    708940 (GNAI1)
   04921 Oxytocin signaling pathway
    708940 (GNAI1)
   04926 Relaxin signaling pathway
    708940 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    708940 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    708940 (GNAI1)
   04916 Melanogenesis
    708940 (GNAI1)
   04924 Renin secretion
    708940 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    708940 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    708940 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    708940 (GNAI1)
   04727 GABAergic synapse
    708940 (GNAI1)
   04725 Cholinergic synapse
    708940 (GNAI1)
   04728 Dopaminergic synapse
    708940 (GNAI1)
   04726 Serotonergic synapse
    708940 (GNAI1)
   04730 Long-term depression
    708940 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    708940 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    708940 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    708940 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    708940 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    708940 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    708940 (GNAI1)
   05032 Morphine addiction
    708940 (GNAI1)
   05034 Alcoholism
    708940 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    708940 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    708940 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    708940 (GNAI1)
   05163 Human cytomegalovirus infection
    708940 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    708940 (GNAI1)
   05142 Chagas disease
    708940 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    708940 (GNAI1)
   04031 GTP-binding proteins [BR:mcc04031]
    708940 (GNAI1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   708940 (GNAI1)
GTP-binding proteins [BR:mcc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    708940 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 708940
NCBI-ProteinID: XP_014989675
Ensembl: ENSMMUG00000023470
UniProt: H9EPA7
LinkDB
Position
3
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgctgagcgccgaggacaaggcggcggtggagcggagtaagatgatcgac
cgcaacctccgcgaggacggcgagaaggcggcgcgcgaggtcaagctgctgctgcttggt
gctggtgaatctggtaaaagtacaattgtgaagcagatgaaaattatccatgaagctggt
tattcagaagaggagtgtaaacagtacaaagcagtcgtctacagtaacaccatccagtcg
attattgctatcattagggccatggggaggttgaagatagactttggtgactcagcccgg
gcggatgatgcacgccaactctttgtgctagctggagctgctgaagaaggctttatgact
gcagaacttgctggagttataaagagattgtggaaagatagtggtgtacaagcctgtttc
aacagatcccgagagtaccagcttaatgattctgcagcatactatttgaatgacttggac
agaatagctcagccaaattacatcccgactcaacaagatgttctcagaactagagtgaaa
actacaggaattgttgaaacccattttactttcaaagatcttcattttaaaatgtttgat
gtgggaggtcagagatctgagcggaagaagtggattcattgcttcgaaggagtgacggcg
atcatcttctgtgtagcactgagtgactacgatctggttctagctgaagatgaagaaatg
aatcgaatgcatgaaagcatgaagttgtttgacagcatatgtaacaacaagtggtttaca
gatacatccattatactttttctcaacaagaaggatctctttgaagaaaaaatcaagaag
agccctctcactatatgctatccagaatatgcaggatcaaacacatatgaagaggcagct
gcatatattcaatgtcagtttgaagacctcaataaaagaaaggacacaaaggaaatatac
acccacttcacatgtgccacagatactaagaatgtgcagtttgtttttgatgctgtaaca
gatgtcatcataaaaaataatctaaaagattgtggtctcttctaa

DBGET integrated database retrieval system