KEGG   Macaca mulatta (rhesus monkey): 613027
Entry
613027            CDS       T01028                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc05160  Hepatitis C
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    613027 (EGFR)
   04012 ErbB signaling pathway
    613027 (EGFR)
   04014 Ras signaling pathway
    613027 (EGFR)
   04015 Rap1 signaling pathway
    613027 (EGFR)
   04630 JAK-STAT signaling pathway
    613027 (EGFR)
   04066 HIF-1 signaling pathway
    613027 (EGFR)
   04068 FoxO signaling pathway
    613027 (EGFR)
   04020 Calcium signaling pathway
    613027 (EGFR)
   04072 Phospholipase D signaling pathway
    613027 (EGFR)
   04151 PI3K-Akt signaling pathway
    613027 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    613027 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    613027 (EGFR)
   04520 Adherens junction
    613027 (EGFR)
   04540 Gap junction
    613027 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    613027 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    613027 (EGFR)
   04915 Estrogen signaling pathway
    613027 (EGFR)
   04921 Oxytocin signaling pathway
    613027 (EGFR)
   04926 Relaxin signaling pathway
    613027 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    613027 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    613027 (EGFR)
   05206 MicroRNAs in cancer
    613027 (EGFR)
   05205 Proteoglycans in cancer
    613027 (EGFR)
   05230 Central carbon metabolism in cancer
    613027 (EGFR)
   05231 Choline metabolism in cancer
    613027 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    613027 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    613027 (EGFR)
   05212 Pancreatic cancer
    613027 (EGFR)
   05225 Hepatocellular carcinoma
    613027 (EGFR)
   05226 Gastric cancer
    613027 (EGFR)
   05214 Glioma
    613027 (EGFR)
   05218 Melanoma
    613027 (EGFR)
   05219 Bladder cancer
    613027 (EGFR)
   05215 Prostate cancer
    613027 (EGFR)
   05213 Endometrial cancer
    613027 (EGFR)
   05224 Breast cancer
    613027 (EGFR)
   05223 Non-small cell lung cancer
    613027 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    613027 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    613027 (EGFR)
   05171 Coronavirus disease - COVID-19
    613027 (EGFR)
   05163 Human cytomegalovirus infection
    613027 (EGFR)
   05165 Human papillomavirus infection
    613027 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    613027 (EGFR)
   01522 Endocrine resistance
    613027 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    613027 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    613027 (EGFR)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     613027 (EGFR)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   613027 (EGFR)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   613027 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   613027 (EGFR)
  Exosomal proteins of bladder cancer cells
   613027 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT Kdo
Other DBs
NCBI-GeneID: 613027
NCBI-ProteinID: XP_014988922
Ensembl: ENSMMUG00000022394
UniProt: P55245
LinkDB
Position
3
AA seq 1210 aa
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSEFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSSQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCQNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQVMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCARNGPKIPSIATGMVGALLLLLVV
ALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQ
QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTED
SIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLN
TVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV
APQSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctccgggacggccggggccgcgctcctggcgctgctggctgcgctctgcccc
gcgagtcgggctctggaggaaaagaaagtttgccaaggcacgagtaacaaactcacgcag
ttgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaattacctacgtgcagaggaattatgatctttccttcttaaag
accatccaggaggtggctggttatgtcctcatcgccctcaacacagtggagcggattcct
ttggaaaacctgcagatcatcagaggaaacatgtactatgaaaattcctatgccttagca
gtcttatctaactatgatgcaaataaaaccggactgaaggagctgcccatgagaaactta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctgccctgtgcaacgtggag
agcatccagtggcgggacatagtcagcagcgagtttctcagcaacatgtcgatggacttc
cagaaccacctgggcagctgccaaaagtgtgatccaagctgtcccaatgggagctgctgg
ggtgcaggagaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctcc
gggcgctgccgcggcaagtcccccagtgactgctgccacaaccagtgtgccgcgggctgc
acgggcccccgggagagcgactgcctggtctgccgcaaattccgagacgaagccacgtgc
aaggacacctgccccccactcatgctctacaaccccaccacataccagatggatgtgaac
cccgagggcaaatacagctttggtgccacctgcgtgaagaagtgtccccgtaattatgtg
gtgacagatcacggctcgtgcgtccgagcctgcggggccgacagctatgagatggaggaa
gacggcgtccgcaagtgtaagaagtgcgaagggccttgccgcaaagtgtgtaatggaata
ggtattggtgaatttaaagacacactctccataaatgctacaaatattaaacacttcaaa
aactgcacctccatcagtggcgatctccacatcctgccggtggcatttaggggtgactcc
ttcacacacactccgcctctggatccacaggaactggatattctgaaaaccgtaaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggacctccatgctttt
gagaacctagaaatcatacgtggcaggaccaagcaacacggtcagttttctcttgcggtc
gtcagcctgaacataacatccttgggattacgctccctcaaggagataagcgatggagat
gtgataatttcaggaaacaaaaatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccagtcagaaaaccaaaattataagcaacagaggtgaaaacagctgcaag
gccacgggccaggtctgccatgccttgtgctcccccgagggctgctggggcccggagccc
agggactgcgtctcctgccagaatgtcagccgaggcagagaatgcgtggacaagtgcaac
atcctggagggcgagccaagggagtttgtggagaactctgagtgcatacagtgccaccca
gaatgcctgccccaggtcatgaacatcacctgcacaggacggggaccagacaactgtatc
cagtgtgcccactacattgacggcccccactgcgtcaagacctgcccagcaggagtcatg
ggagaaaacaacaccctggtctggaagtacgcagacgccggccacgtgtgccacctgtgc
catccaaactgcacctacggatgcactgggccaggtcttgaaggctgtgcaaggaacggg
cctaagatcccatccatcgccactgggatggtgggggccctcctcttgctgctggtggtg
gccctggggatcggcctcttcatgcgaaggcgccacatcgttcggaagcgcacactgcgg
aggctgctgcaggagagggagcttgtggagcctcttacgcccagtggagaagctcccaac
caagctctcttgaggatcttgaaggaaactgaattcaagaagatcaaagtgctgggctcc
ggtgcgttcggaactgtgtataagggactctggatcccagaaggtgagaaagttaaaatt
cccgtcgctatcaaggaattaagagaagcaacatctccgaaagccaacaaggaaatcctc
gatgaagcctacgtgatggccagcgtggacaacccccatgtgtgccgcctgctgggcatc
tgcctcacctccaccgtgcagctcattacgcagctcatgcccttcggctgcctcctggac
tacgtccgggaacacaaggacaatatcggctcccagtacctgctcaactggtgtgtgcag
attgcaaagggcatgaactacttggaggaccggcgcttggtgcaccgcgacctggcagcc
aggaacgtactggtgaaaacgccacagcatgtcaagatcacggattttgggctggccaaa
ctgctgggtgcagaagagaaagaataccatgcagaaggaggcaaagtgcctatcaagtgg
atggcattggaatcaattttacaccgaatttatacccaccagagtgatgtctggagctac
ggggtgaccgtttgggagttgatgacctttggatccaagccatatgacggaatccctgcc
agcgagatctcctccatcctggagaaaggagaacgcctcccccagccacccatatgtacc
atcgatgtctacatgatcatggtcaagtgctggatgatagacgcagatagtcgcccaaag
ttccgtgagttgatcattgaattctccaaaatggcccgagacccccagcgctaccttgtt
attcagggggatgaaagaatgcatttgccaagccctacagactccaacttctaccgtgcc
ctgatggatgaagaagacatggacgacgtggtggatgccgacgagtacctcatcccacag
caaggcttcttcagcagcccctccacgtcacggactcccctcctgagctctctgagtgca
accagcaacaattccactgtggcttgcattgatagaaatgggctgcaaagctgtcccatc
aaggaagacagcttcttacagcgatacagctcagaccccacaggcgccttgactgaggac
agcatagacgacaccttcctcccagtgcctgaatacataaaccagtctgttcccaaaagg
cccgctggctctgtgcagaatcctgtctatcacaatcagcctctgaaccctgcgcccagc
agagacccacactaccaggacccccacagcaccgcagtgggcaaccccgagtatctcaac
actgtccagcccacctgtgtcaacagcacattcgacagccctgctcattgggcccagaaa
ggcagccaccaaattagcctggacaaccctgactaccagcaggacttctttcccaaggaa
gccaagccaaatggcatctttaagggctccacagctgaaaatgcagaatacctaagggtc
gcaccacaaagcagtgaatttattggagcatga

DBGET integrated database retrieval system