KEGG   Macaca mulatta (rhesus monkey): 613027
Entry
613027            CDS       T01028                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc05160  Hepatitis C
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    613027 (EGFR)
   04012 ErbB signaling pathway
    613027 (EGFR)
   04014 Ras signaling pathway
    613027 (EGFR)
   04015 Rap1 signaling pathway
    613027 (EGFR)
   04630 JAK-STAT signaling pathway
    613027 (EGFR)
   04066 HIF-1 signaling pathway
    613027 (EGFR)
   04068 FoxO signaling pathway
    613027 (EGFR)
   04020 Calcium signaling pathway
    613027 (EGFR)
   04072 Phospholipase D signaling pathway
    613027 (EGFR)
   04151 PI3K-Akt signaling pathway
    613027 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    613027 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    613027 (EGFR)
   04520 Adherens junction
    613027 (EGFR)
   04540 Gap junction
    613027 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    613027 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    613027 (EGFR)
   04915 Estrogen signaling pathway
    613027 (EGFR)
   04921 Oxytocin signaling pathway
    613027 (EGFR)
   04926 Relaxin signaling pathway
    613027 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    613027 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    613027 (EGFR)
   05206 MicroRNAs in cancer
    613027 (EGFR)
   05205 Proteoglycans in cancer
    613027 (EGFR)
   05230 Central carbon metabolism in cancer
    613027 (EGFR)
   05231 Choline metabolism in cancer
    613027 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    613027 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    613027 (EGFR)
   05212 Pancreatic cancer
    613027 (EGFR)
   05225 Hepatocellular carcinoma
    613027 (EGFR)
   05226 Gastric cancer
    613027 (EGFR)
   05214 Glioma
    613027 (EGFR)
   05218 Melanoma
    613027 (EGFR)
   05219 Bladder cancer
    613027 (EGFR)
   05215 Prostate cancer
    613027 (EGFR)
   05213 Endometrial cancer
    613027 (EGFR)
   05224 Breast cancer
    613027 (EGFR)
   05223 Non-small cell lung cancer
    613027 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    613027 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    613027 (EGFR)
   05171 Coronavirus disease - COVID-19
    613027 (EGFR)
   05163 Human cytomegalovirus infection
    613027 (EGFR)
   05165 Human papillomavirus infection
    613027 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    613027 (EGFR)
   01522 Endocrine resistance
    613027 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    613027 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    613027 (EGFR)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     613027 (EGFR)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   613027 (EGFR)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   613027 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   613027 (EGFR)
  Exosomal proteins of bladder cancer cells
   613027 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT Kdo
Other DBs
NCBI-GeneID: 613027
NCBI-ProteinID: XP_014988922
Ensembl: ENSMMUG00000022394
UniProt: P55245
LinkDB
Position
3
AA seq 1210 aa
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSEFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSSQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCQNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQVMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCARNGPKIPSIATGMVGALLLLLVV
ALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQ
QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTED
SIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLN
TVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV
APQSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctccgggacggccggggccgcgctcctggcgctgctggctgcgctctgcccc
gcgagtcgggctctggaggaaaagaaagtttgccaaggcacgagtaacaaactcacgcag
ttgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaattacctacgtgcagaggaattatgatctttccttcttaaag
accatccaggaggtggctggttatgtcctcatcgccctcaacacagtggagcggattcct
ttggaaaacctgcagatcatcagaggaaacatgtactatgaaaattcctatgccttagca
gtcttatctaactatgatgcaaataaaaccggactgaaggagctgcccatgagaaactta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctgccctgtgcaacgtggag
agcatccagtggcgggacatagtcagcagcgagtttctcagcaacatgtcgatggacttc
cagaaccacctgggcagctgccaaaagtgtgatccaagctgtcccaatgggagctgctgg
ggtgcaggagaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctcc
gggcgctgccgcggcaagtcccccagtgactgctgccacaaccagtgtgccgcgggctgc
acgggcccccgggagagcgactgcctggtctgccgcaaattccgagacgaagccacgtgc
aaggacacctgccccccactcatgctctacaaccccaccacataccagatggatgtgaac
cccgagggcaaatacagctttggtgccacctgcgtgaagaagtgtccccgtaattatgtg
gtgacagatcacggctcgtgcgtccgagcctgcggggccgacagctatgagatggaggaa
gacggcgtccgcaagtgtaagaagtgcgaagggccttgccgcaaagtgtgtaatggaata
ggtattggtgaatttaaagacacactctccataaatgctacaaatattaaacacttcaaa
aactgcacctccatcagtggcgatctccacatcctgccggtggcatttaggggtgactcc
ttcacacacactccgcctctggatccacaggaactggatattctgaaaaccgtaaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggacctccatgctttt
gagaacctagaaatcatacgtggcaggaccaagcaacacggtcagttttctcttgcggtc
gtcagcctgaacataacatccttgggattacgctccctcaaggagataagcgatggagat
gtgataatttcaggaaacaaaaatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccagtcagaaaaccaaaattataagcaacagaggtgaaaacagctgcaag
gccacgggccaggtctgccatgccttgtgctcccccgagggctgctggggcccggagccc
agggactgcgtctcctgccagaatgtcagccgaggcagagaatgcgtggacaagtgcaac
atcctggagggcgagccaagggagtttgtggagaactctgagtgcatacagtgccaccca
gaatgcctgccccaggtcatgaacatcacctgcacaggacggggaccagacaactgtatc
cagtgtgcccactacattgacggcccccactgcgtcaagacctgcccagcaggagtcatg
ggagaaaacaacaccctggtctggaagtacgcagacgccggccacgtgtgccacctgtgc
catccaaactgcacctacggatgcactgggccaggtcttgaaggctgtgcaaggaacggg
cctaagatcccatccatcgccactgggatggtgggggccctcctcttgctgctggtggtg
gccctggggatcggcctcttcatgcgaaggcgccacatcgttcggaagcgcacactgcgg
aggctgctgcaggagagggagcttgtggagcctcttacgcccagtggagaagctcccaac
caagctctcttgaggatcttgaaggaaactgaattcaagaagatcaaagtgctgggctcc
ggtgcgttcggaactgtgtataagggactctggatcccagaaggtgagaaagttaaaatt
cccgtcgctatcaaggaattaagagaagcaacatctccgaaagccaacaaggaaatcctc
gatgaagcctacgtgatggccagcgtggacaacccccatgtgtgccgcctgctgggcatc
tgcctcacctccaccgtgcagctcattacgcagctcatgcccttcggctgcctcctggac
tacgtccgggaacacaaggacaatatcggctcccagtacctgctcaactggtgtgtgcag
attgcaaagggcatgaactacttggaggaccggcgcttggtgcaccgcgacctggcagcc
aggaacgtactggtgaaaacgccacagcatgtcaagatcacggattttgggctggccaaa
ctgctgggtgcagaagagaaagaataccatgcagaaggaggcaaagtgcctatcaagtgg
atggcattggaatcaattttacaccgaatttatacccaccagagtgatgtctggagctac
ggggtgaccgtttgggagttgatgacctttggatccaagccatatgacggaatccctgcc
agcgagatctcctccatcctggagaaaggagaacgcctcccccagccacccatatgtacc
atcgatgtctacatgatcatggtcaagtgctggatgatagacgcagatagtcgcccaaag
ttccgtgagttgatcattgaattctccaaaatggcccgagacccccagcgctaccttgtt
attcagggggatgaaagaatgcatttgccaagccctacagactccaacttctaccgtgcc
ctgatggatgaagaagacatggacgacgtggtggatgccgacgagtacctcatcccacag
caaggcttcttcagcagcccctccacgtcacggactcccctcctgagctctctgagtgca
accagcaacaattccactgtggcttgcattgatagaaatgggctgcaaagctgtcccatc
aaggaagacagcttcttacagcgatacagctcagaccccacaggcgccttgactgaggac
agcatagacgacaccttcctcccagtgcctgaatacataaaccagtctgttcccaaaagg
cccgctggctctgtgcagaatcctgtctatcacaatcagcctctgaaccctgcgcccagc
agagacccacactaccaggacccccacagcaccgcagtgggcaaccccgagtatctcaac
actgtccagcccacctgtgtcaacagcacattcgacagccctgctcattgggcccagaaa
ggcagccaccaaattagcctggacaaccctgactaccagcaggacttctttcccaaggaa
gccaagccaaatggcatctttaagggctccacagctgaaaatgcagaatacctaagggtc
gcaccacaaagcagtgaatttattggagcatga

KEGG   Macaca mulatta (rhesus monkey): 697002
Entry
697002            CDS       T01028                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    697002 (PDGFRA)
   04014 Ras signaling pathway
    697002 (PDGFRA)
   04015 Rap1 signaling pathway
    697002 (PDGFRA)
   04630 JAK-STAT signaling pathway
    697002 (PDGFRA)
   04020 Calcium signaling pathway
    697002 (PDGFRA)
   04072 Phospholipase D signaling pathway
    697002 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    697002 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    697002 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    697002 (PDGFRA)
   04540 Gap junction
    697002 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    697002 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    697002 (PDGFRA)
   05206 MicroRNAs in cancer
    697002 (PDGFRA)
   05230 Central carbon metabolism in cancer
    697002 (PDGFRA)
   05231 Choline metabolism in cancer
    697002 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    697002 (PDGFRA)
   05218 Melanoma
    697002 (PDGFRA)
   05215 Prostate cancer
    697002 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    697002 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    697002 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    697002 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    697002 (PDGFRA)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     697002 (PDGFRA)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   697002 (PDGFRA)
CD molecules [BR:mcc04090]
 Proteins
  697002 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 697002
NCBI-ProteinID: XP_014994177
Ensembl: ENSMMUG00000017395
UniProt: G7MTB0 A0A5F8AGH5
LinkDB
Position
5
AA seq 1089 aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYNSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKRVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVQAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGMPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHPRD
RSTVEGLVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADDSTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatccggcgttcctggtcttaggctgtcttctcacagggctgagccta
atcctctgccagctttcgttaccctctatccttccaaatgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaactctgatgtggaaatcagaaatgaagaaaacaacagtggcctt
tttgtgacagtcttggaagtgagcagtgcctcggcggcccacacagggctgtacacttgc
tattacaaccacactcagacagaagagaatgagcttgaaggcaggcacatttacatctat
gtgccagacccagatgtagcctttgtacctctaggaatgacggattatttagtcatcgtg
gaggacgatgattctgccatcataccttgtcgcacaactgatcctgagactcctgtaact
ttacacaacagtgagggggtggtacctgcctcctacaacagcagacagggctttaatggg
accttcactgtagggccctatatctgtgaggccaccgtcaaaggaaagaagttccagacc
atcccatttaacgtttatgctttaaaagcaacatcagagctggatctagaaatggaagct
cttaaaaccgtgtataagtcaggggaaacgattgtggtcacctgtgctgtttttaacaat
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaagaaatcaaagtcccatccatcaaattggtgtacactttgacggtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggctaccagggaggtcaaa
gaaatgaagagagtcactatttctgtccatgagaaagggttcattgaaatcaaacccacc
tttagccagttggaagctgtcaacctgcatgaagtcaaacattttgtcgtagaggtgcag
gcctacccacctcccaggatatcctggctgaaaaacaatctgactctgattgaaaacctc
acggagatcaccactgatgtggaaaagattcaggaaataaggtatcgaagcaaattaaag
cttatccgtgctaaggaagaagacagtggccattatactattgtagctcaaaatgaagat
gatgtgaagagctatacttttgaactgttaactcaagttccttcatccattctggacttg
gtcgatgatcaccatggctcaactgggggacagacggtgaggtgcacagctgaaggcatg
ccacttcctgatattgagtggatgatatgcaaggatattaagaaatgtaataatgaaact
tcctggacgattttggccaacaatgtctcaaacatcatcacggagatccacccccgagac
aggagtaccgtggagggccttgtgacttttgccaaagtggaagagaccattgcggtgaga
tgcctggctaagaatctccttggagctgagaaccgagagctgaagctggtggctcccacc
ctgcgttctgaactcacggtggctgccgcagtcctggtgctgctggtgattgtgatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagcccagatggacatgaatatatttatgtggacccaatgcagctg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgggtcttgggg
tctggagcgtttgggaaggtggttgaaggaacagcctatggattaagccggtcccaacct
gtcatgaaagttgcagtgaagatgctaaaacccacggccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccacatttgaacattgtaaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcacagagtactgcttctacgga
gatttggtcaactatttgcataagaatagggatagcttcctgagccgccacccagagaag
ccaaagaaagagctggatatctttgggttgaaccctgctgatgacagcacacggagctat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgatactaca
cagtatgtccctatgctagaaaggaaagaggtttctaaatattccgacatccagagatca
ctgtatgatcgtccagcctcatataagaagaaatctatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggccttactttgttggatttgttgagcttcacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgggatctggct
gctcgcaacgtcctcctggcacaaggaaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactatgtgtcgaaaggcagtacctttctgcccgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacactgagtgatgtctggtct
tacggcattctgctctgggagatcttttcccttggtggtactccttaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccat
gctaccagtgaagtctacgagatcatggtgaaatgctggaacagtgagccagagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaaaattcacctggacttcctgaagagtgaccatcctgctgtggcacgcatg
cgtgtggactcagacaatgcgtacattggtgtcacctacaaaaatgaggaagacaagctg
aaggactgggagggtggtctggatgagcagagactgagcgctgacagcggctacatcatt
cctctgcctgacattgaccctgtccctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccattgagacgggttccagcagttccaccttcatc
aagagagaggacgagaccattgaagacatcgacatgatggacgacatcggcatagactct
tcagacctggtggaagacagcttcctgtaa

KEGG   Macaca mulatta (rhesus monkey): 700126
Entry
700126            CDS       T01028                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1 precursor
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04520  Adherens junction
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04714  Thermogenesis
mcc04810  Regulation of actin cytoskeleton
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05224  Breast cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    700126 (FGFR1)
   04014 Ras signaling pathway
    700126 (FGFR1)
   04015 Rap1 signaling pathway
    700126 (FGFR1)
   04020 Calcium signaling pathway
    700126 (FGFR1)
   04151 PI3K-Akt signaling pathway
    700126 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    700126 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    700126 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    700126 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    700126 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    700126 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    700126 (FGFR1)
   05205 Proteoglycans in cancer
    700126 (FGFR1)
   05230 Central carbon metabolism in cancer
    700126 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    700126 (FGFR1)
   05215 Prostate cancer
    700126 (FGFR1)
   05224 Breast cancer
    700126 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    700126 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    700126 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    700126 (FGFR1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     700126 (FGFR1)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   700126 (FGFR1)
CD molecules [BR:mcc04090]
 Proteins
  700126 (FGFR1)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   700126 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 FGFR3_TM V-set C2-set_2 Ig_6 Pkinase_fungal DUF1615
Other DBs
NCBI-GeneID: 700126
NCBI-ProteinID: NP_001253576
Ensembl: ENSMMUG00000022478
UniProt: H9FRD4
LinkDB
Position
8
AA seq 731 aa
MWSWKCLLFWAVLVTATLCTARPSPTLPEQDALPSSEDDDDDDDSSSEEKETDNTKPNPV
APYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYA
TWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGS
NVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNV
SFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMV
GSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSS
SGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKV
AVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLRE
YLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLV
TEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLW
EIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLV
EDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHP
AQLANGGLKRR
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacgctctgcacc
gctaggccgtccccgaccttgcctgaacaagatgctctcccctcctcagaggatgatgat
gatgatgatgactcctcttcagaggagaaagagacagataacaccaaaccaaaccccgta
gctccatattggacatccccagaaaagatggaaaagaaattgcatgcggtgccagctgcc
aagacagtgaagttcaaatgcccttccagtgggaccccaaaccccacactgcgctggttg
aaaaatggcaaagaattcaaacctgaccacaggattggaggctacaaggtccgttatgcc
acctggagcatcataatggactccgtggtgccctctgacaagggcaactacacctgcatt
gtggagaatgagtatggcagcatcaaccacacctaccagctggatgtcgtggagcggtcc
cctcaccggcccatcctgcaagcagggttgcccgccaacaagacagtggccctgggtagc
aacgtggagttcatgtgtaaggtgtacagtgacccacagccgcatatccagtggctaaag
cacatcgaggtgaacgggagcaagattggtccagacaacctgccttatgtccagatcttg
aagactgctggagttaataccaccgacaaagagatggaggtgcttcacttaagaaatgtc
tcctttgaggacgcaggggagtatacgtgcttggcgggtaactctatcggactctcccat
cactctgcatggttgaccgttctggaagctctggaagagaggccggcggtgatgacctcg
cccctgtacctggagatcatcatctattgcacaggggccttcctcatctcctgcatggta
gggtcggtcatcgtctacaagatgaagagtggcaccaagaagagcgacttccacagccag
atggctgtgcacaagctggccaagagcatccctctgcgcagacaggtaacagtgtctgct
gactccagtgcgtccatgaactctggggttcttctggttcggccatcacggctctcctcc
agtgggactcccatgctagcaggggtctccgagtatgagcttcctgaagaccctcgctgg
gagctgcctcgggacagactggtcttaggcaaacccctgggagagggctgctttgggcag
gtggtgttggcagaggccatcgggttggacaaggacaaacccaaccgtgtgaccaaagtg
gctgtgaagatgttgaagtcggacgcaacagagaaagacttgtcagacctgatctcagaa
atggagatgatgaagatgatcgggaagcataagaatatcatcaacctgctgggggcctgc
acgcaggacggtcccttgtatgtcatcgtggagtatgcctccaagggcaacctgcgggag
tacctgcaggcccggaggcccccggggctggaatactgctacaaccccagccacaaccca
gaggagcagctctcctccaaggacctggtgtcctgcgcctatcaggtggcccgaggcatg
gagtatctggcctccaagaagtgcatacaccgagacctggccgccaggaatgtcctggtg
acagaggacaatgtgatgaagatagcagactttggcctcgcacgggacattcaccacatc
gactactataaaaagacaaccaacggtcgactgcctgtgaagtggatggcgcccgaggca
ttgtttgaccggatctacacccaccagagtgatgtgtggtctttcggggtgcttctgtgg
gagatcttcactctgggcggctccccataccctggtgtgcctgtggaggagcttttcaag
ctgctgaaggagggtcaccgcatggacaagcccagtaactgcaccaacgagctgtacatg
atgatgcgggactgctggcatgcagtgccctcacagagacccaccttcaagcagctggtg
gaagacctggaccgcatcgtggccttgacctccaaccaggagtacctggacctgtccatg
cccctggaccagtactccccgagctttcccgacacccggagctctacatgctcctcaggg
gaggattccgtcttctctcatgagccgctgcccgaggagccctgcctgccccgacaccca
gcccagcttgccaatggcggactcaaacgccgctga

KEGG   Macaca mulatta (rhesus monkey): 704562
Entry
704562            CDS       T01028                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor precursor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc05100  Bacterial invasion of epithelial cells
mcc05144  Malaria
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05211  Renal cell carcinoma
mcc05218  Melanoma
mcc05223  Non-small cell lung cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    704562 (MET)
   04014 Ras signaling pathway
    704562 (MET)
   04015 Rap1 signaling pathway
    704562 (MET)
   04020 Calcium signaling pathway
    704562 (MET)
   04151 PI3K-Akt signaling pathway
    704562 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    704562 (MET)
   04520 Adherens junction
    704562 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    704562 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    704562 (MET)
   05202 Transcriptional misregulation in cancer
    704562 (MET)
   05206 MicroRNAs in cancer
    704562 (MET)
   05205 Proteoglycans in cancer
    704562 (MET)
   05230 Central carbon metabolism in cancer
    704562 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    704562 (MET)
   05226 Gastric cancer
    704562 (MET)
   05218 Melanoma
    704562 (MET)
   05211 Renal cell carcinoma
    704562 (MET)
   05223 Non-small cell lung cancer
    704562 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    704562 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    704562 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    704562 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    704562 (MET)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     704562 (MET)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  MET family
   704562 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema TIG Pkinase PSI Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 704562
NCBI-ProteinID: NP_001162100
Ensembl: ENSMMUG00000006779
UniProt: G7MM61
LinkDB
Position
3
AA seq 1381 aa
MKAPAVLVPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETAIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPNQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPHHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYIHAFESNNFIYFLTVQRETLNAQTFHTRIIRFCSLNSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRAEF
TTALQRVDLFMGQFSEVLLTSISTFVKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHPLNQNGYTLVVTGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECPSGTWTQQICLPAIYKVFPTSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPIIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLHSVSVPRMVINVH
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISIALLLLLGLFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
T
NT seq 4146 nt   +upstreamnt  +downstreamnt
atgaaggcccccgctgtgcttgtacctggcatcctcgtgctcctgtttaccttggtgcag
aggagcaatggggagtgtaaagaggcactagcaaagtccgagatgaatgtgaatatgaag
tatcagcttcccaacttcaccgcggaaacagccatccagaatgtcattctacatgagcat
cacattttcctcggtgccaccaactacatttatgttttaaatgaggaagaccttcagaag
gttgctgagtacaagaccgggcctgtgctggaacacccagattgtttcccgtgtcaggac
tgcagcagcaaagccaatttatcaggaggcgtttggaaagataacatcaacatggctctg
gttgtcgacacctactatgatgatcaactcattagctgtggcagcgtcaacagagggacc
tgccagcgacatgtctttccccataatcatactgctgacatacagtcggaggttcactgc
atattctccccacagatagaagagcccaaccagtgccctgactgtgtggtgagcgccctg
ggagccaaagtcctttcatctgtaaaggaccggttcatcaacttctttgtaggcaatacc
ataaattcttcttatttcccacatcatccgttgcattcgatatcagtgagaaggctaaag
gaaacgaaagatggttttatgtttttgacggaccagtcctacattgatgttttacctgag
ttcagagattcttaccccattaagtacatccatgcttttgaaagcaacaattttatttac
ttcttgacggtccaaagggaaactctaaatgctcagacttttcacacaagaataatcagg
ttctgttccttaaactctggattgcactcctacatggaaatgcctctagagtgtattctc
acagaaaagagaaaaaagagatccacaaagaaggaagtgtttaatatccttcaggctgca
tatgtcagcaagcccggggcccagcttgctagacaaataggagccagcctgaatgatgac
attctctttggggtgttcgcacaaagcaagccagattctgccgaaccaatggatcgatct
gcaatgtgtgcattccctatcaaatatgtcaacgacttcttcaacaagatcgtcaacaaa
aacaatgtgagatgtctccagcatttttatggacccaatcatgagcactgttttaatagg
acacttctgagaaattcatcaggctgtgaagcgcgccgtgatgaatatcgagcagagttt
accacagctttgcagcgcgttgacttattcatgggtcaattcagcgaagtcctcttaaca
tctatatccaccttcgtgaaaggagacctcaccatcgctaatcttgggacatcagagggt
cgcttcatgcaggttgtggtttctcgatcaggaccatcaacccctcatgtgaattttctc
ctggactctcacccggtgtctccagaagtgattgtggagcatccattaaaccagaatggc
tacacactggttgtcacggggaagaagatcaccaagatcccattgaatggcttgggctgc
agacatttccagtcctgcagtcagtgcctctctgccccaccctttgtgcagtgtggctgg
tgccacgacaaatgtgtgcgatcggaggagtgccccagtgggacatggactcaacagatc
tgtctgcctgcaatctacaaggttttcccaactagtgcaccccttgaaggagggacaaga
ctgaccatatgtggctgggactttggatttcggaggaataataaatttgatttaaagaaa
actagagttctccttggaaatgagagctgcaccttgactttaagtgagagcacgatgaat
acattgaaatgcacagttggtcctgccatgaataaacatttcaatatgtccataattatt
tcaaatggccatgggacaacacaatacagtacattttcctatgtggatcctataataaca
agtatttcgccaaaatatggccctatggctggtggcactttacttactttaactggaaat
tacctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtactttaaaa
agtgtgtcaaacagtattctcgaatgttataccccagcccaaaccatttcaactgagttt
gctgttaaattgaaaattgacttagccaaccgagagacaagcatcttcagttaccgggaa
gaccccattgtctatgaaattcatccaaccaaatcttttattagtggtgggagcacaata
acaggtgttgggaaaaacctgcattcagttagtgtcccgaggatggtcataaatgtgcat
gaagcaggaaggaactttacagtggcatgtcagcatcgctctaattcagagataatctgc
tgtaccactccttccctgcaacagctgaatctgcaactccctctgaaaaccaaagccttt
ttcatgttagatgggatcctttccaaatactttgatctcatttatgtacataatcctgtg
tttaagccttttgaaaagccagtaatgatctcaatgggcaatgaaaatgtactggaaatt
aagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaataag
agctgtgagaatatacacttacattctgaagccgttttatgcacggtccccaatgacctg
ctgaaattgaacagcgagctaaatatagagtggaagcaagcaatttcttcaaccgtcctt
ggaaaagtaatagttcaaccagatcagaatttcaccggattgattgctggtgttgtctca
atatcaatagcactcttactactacttgggcttttcctgtggctgaaaaagagaaagcaa
attaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcatttg
gataggcttgtaagtgcccgaagtgtaagcccaacaacagaaatggtttcaaatgaatct
gtagactaccgagctacttttccagaagatcagtttcctaattcatctcagaacggttca
tgccgacaagtgcagtatcctctgacagacatgtcccccatcctgactagtggggactct
gatatatccagtccattactgcaaaacactgtccacattgacctcagcgctctaaatcca
gagctggtccaggcagtgcagcatgtagtgattgggcccagtagcctgattgtgcatttc
aatgaagtcataggaagagggcattttggttgtgtatatcatgggactttgttggacaat
gatggcaagaaaattcactgtgctgtgaaatccttgaacagaatcactgacataggagaa
gtttcccagtttctgaccgagggaatcatcatgaaagattttagtcatcccaatgtcctc
tcgctcctgggaatctgcctgcgaagtgaagggtctccgctggtggtcctaccctacatg
aaacatggagatcttcgaaatttcattcgaaatgagactcataatccaactgtaaaagat
cttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaagttt
gtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcacagtcaaggtt
gctgattttggtcttgccagagacatgtatgataaagaatactatagtgtgcacaacaaa
acaggtgcaaagctgccagtgaagtggatggctttggaaagtctgcaaactcaaaagttt
accaccaagtcagatgtgtggtcctttggtgtgctcctctgggagctcatgacaagagga
gccccaccctatcctgacgtgaacacctttgatataactgtttacttgttgcaagggaga
aggctcctacaacccgaatactgcccagaccccttatatgaagtaatgctaaaatgctgg
caccctaaagcagaaatgcgcccatccttttctgaactggtgtcccggatatcagcgatc
ttctctactttcattggggagcactacgtccatgtaaacgctacttatgtgaacgtaaaa
tgtgtcgctccatatccttctctgttgtcatcagaagataacgctgatgacgaggtggac
acatga

KEGG   Macaca mulatta (rhesus monkey): 708227
Entry
708227            CDS       T01028                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor precursor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04114  Oocyte meiosis
mcc04140  Autophagy - animal
mcc04144  Endocytosis
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04730  Long-term depression
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05205  Proteoglycans in cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    708227 (IGF1R)
   04014 Ras signaling pathway
    708227 (IGF1R)
   04015 Rap1 signaling pathway
    708227 (IGF1R)
   04066 HIF-1 signaling pathway
    708227 (IGF1R)
   04068 FoxO signaling pathway
    708227 (IGF1R)
   04151 PI3K-Akt signaling pathway
    708227 (IGF1R)
   04152 AMPK signaling pathway
    708227 (IGF1R)
   04150 mTOR signaling pathway
    708227 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    708227 (IGF1R)
   04140 Autophagy - animal
    708227 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    708227 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    708227 (IGF1R)
   04520 Adherens junction
    708227 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    708227 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    708227 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    708227 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    708227 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    708227 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    708227 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    708227 (IGF1R)
   05202 Transcriptional misregulation in cancer
    708227 (IGF1R)
   05205 Proteoglycans in cancer
    708227 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    708227 (IGF1R)
   05214 Glioma
    708227 (IGF1R)
   05218 Melanoma
    708227 (IGF1R)
   05215 Prostate cancer
    708227 (IGF1R)
   05224 Breast cancer
    708227 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    708227 (IGF1R)
   01522 Endocrine resistance
    708227 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    708227 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    708227 (IGF1R)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     708227 (IGF1R)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   708227 (IGF1R)
CD molecules [BR:mcc04090]
 Proteins
  708227 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 708227
NCBI-ProteinID: NP_001248281
Ensembl: ENSMMUG00000012305
UniProt: I2CWY3 G7MWA6
LinkDB
Position
7
AA seq 1367 aa
MKSGSGEGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSACGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTVADTYNITDLEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKDEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4104 nt   +upstreamnt  +downstreamnt
atgaagtctggctctggagaagggtccccgacctcgctgtgggggctcctgtttctctcc
gccgcgctctcgctctggccgacgagtggagaaatctgtgggccgggcatcgacatccgc
aacgactatcagcagctgaagcgcctggagaactgcacggtgatcgagggctacctccac
atcctgctcatctccaaggccgaggactaccgcagctaccgcttccccaagctcacggtc
atcaccgagtacttgctgttgttccgagtggctggcctagagagcctcggagacctgttc
cccaacctcacggtaatccgcggctggaaactcttctacaactacgccctggtcatcttt
gagatgaccaatctcaaggatattgggctttacaacctgaggaacattactcggggggcc
atcaggattgagaaaaatgctgacctctgttacctctccactgtggactggtccctgatc
ctggatgcagtgtccaataactacattgtggggaataagcccccaaaggaatgcggggac
ctgtgtccggggaccatggaggagaagccgatgtgcgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaaccgctgccagaaaatgtgcccgagtgcctgtggg
aagagggcatgcaccgagaacaacgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcctgacaacgacacggcctgtgtagcttgccgccactactactacgccggtgtctgc
gtgcctgcctgcccgcccaacacctacaggtttgagggctggcgctgtgtggaccgtgac
ttctgcgccaacatcctcagtgccgagagcagcgactccgagggtttcgtgatccacgac
ggcgagtgcatgcaggagtgcccctcaggcttcatccgcaacggcagccagagcatgtac
tgcatcccttgtgaaggtccttgccccaaggtctgtgaggaagaaaagaaaacaaagacc
attgattctgttacttctgctcagatgcttcaaggatgcaccatcttcaagggcaatttg
ctcattaacatccgacgggggaataacattgcttcagaactggagaacttcatggggctc
atcgaggtggtgacgggctacgtgaagatccgccattcccatgccttggtctccttgtcc
ttcctaaaaaaccttcgcctcatcttaggagaggagcagctagaagggaattactccttc
tacgtcctcgacaaccagaacttgcagcaactatgggactgggaccaccgcaacctgacc
atcaaagcagggaaaatgtactttgctttcaatcccaaattgtgtgtttcggaaatttac
cgcatggaggaagtgacggggactaaagggcgccaaagcaaaggggacataaacaccagg
aacaacggggaaagagcctcctgtgaaagtgacgtcctgcatttcacctccaccaccacg
tggaagaatcgcatcatcataacctggcaccggtaccggccccctgactacagggatctc
atcagcttcaccgtttactacaaggaagcaccttttaagaatgtcacggagtatgatggg
caggatgcctgcggctccaacagctggaacatggtggacgtggacctcccgcccaacaag
gacgtggagcccggcatcttactgcatgggctgaagccctggactcagtacgccgtttac
gtcaaggctgtgaccctcaccatggtggagaacgaccatatccgtggggccaagagtgag
atcttgtacattcgcaccaatgcttcagttccttccattcccttggacgttctttcagca
tcgaactcctcttctcagttaatcgtgaagtggaaccctccctctctgcccaacggcaac
ctgagttactacattgtgcgctggcagcggcagcctcaggacggctacctttaccggcac
aattactgctccaaagacaaaatccccatcaggaagtatgccgacggcaccattgacatt
gaggaggtcacagagaacccgaagactgaggtgtgtggtggagagaaagggccttgctgc
gcctgccccaaaactgaagctgagaagcaggccgagaaggaggaggctgagtaccgcaaa
gtctttgagaatttcctgcacaactccatctttgtgcccagacctgaaaggaagcggaga
gatgtcatgcaagtggccaacaccaccatgtccagccgaagcaggaacaccacggtggca
gacacctacaacatcacagatctggaagagctagagacagagtaccctttctttgagagc
agagtggataataaggagagaactgtcatttctaaccttcggcctttcacattgtaccgc
attgatatccacagctgcaaccacgaggctgagaaactgggctgcagcgcctccaacttt
gtctttgcaaggactatgcctgcagaaggagcagatgacattcctgggccagtgacctgg
gagccaaggcctgaaaactccatctttttaaagtggccagaacctgagaatcccaatgga
ttgattctaatgtatgaaataaaatacggatcacaagttgaggatcagcgagaatgtgtg
tccagacaggaatacaggaagtatggaggggccaagctaaaccggctaaacccggggaac
tacacagcccggattcaggctacatctctctctgggaatgggtcgtggacagatcctgtg
ttcttctatgtccaggccaaaacaggatacgaaaacttcatccatctgatcatcgctctg
cccgtcgctgtcctgttgatcgtgggagggttggtgatcatgctgtacgtcttccataga
aagagaaataacagcaggctggggaatggagtgctgtacgcgtctgtgaacccggagtac
ttcagcgctgcggatgtgtacgttcctgatgagtgggaggtggctcgggagaagatcacc
atgagccgggaacttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggt
gtggtgaaagacgaacctgaaaccagagtggccattaaaacagtgaacgaggccgcgagc
atgcgtgaaaggatcgagtttctcaacgaggcttctgtgatgaaggagttcaattgtcac
catgtggtgcggttgctgggtgtggtgtcccagggccagccaacgctggtcatcatggaa
ctgatgacgcggggcgatctcaaaagttatctccggtctctgaggccagaaatggagaat
aatccagtcctagcacctccaagcctaagcaagatgattcagatggctggagagattgca
gacggcatggcatacctcaacgccaacaagttcgtccacagagaccttgctgcccggaat
tgcatggtagccgaggatttcacagtcaaaattggagattttgggatgacgcgagatatc
tatgagacagactattaccggaaaggagggaaagggctgttgcccgtgcgctggatgtct
cccgagtccctcaaggatggagtcttcaccacttactcggacgtctggtccttcggggtt
gtcctctgggagatcgccacactggccgagcagccctaccagggcttgtccaacgagcaa
gtccttcgcttcgtcatggagggcggccttctggacaagccagacaactgccccgacatg
ctgtttgaattgatgcgcatgtgctggcagtacaaccccaagatgaggccttccttcctg
gagatcatcagcagcatcaaagacgagatggagcctggcttccgggaggtctccttctac
tacagtgaggagaacaagctgcccgagccggaggagctggacctggagccagagaacatg
gagagcgtccccctggacccctcggcctcctcgtcctccctgccactgcccgacagacac
tcaggacacaaggccgagaacggccccggccctggagtgctggtgctccgcgccagcttc
gatgagagacagccttacgcacacatgaacggtggccgcaagaacgagcgggccttgccg
ctgccccagtcttcgacctgctga

KEGG   Macaca mulatta (rhesus monkey): 711353
Entry
711353            CDS       T01028                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    711353 (PDGFRB)
   04014 Ras signaling pathway
    711353 (PDGFRB)
   04015 Rap1 signaling pathway
    711353 (PDGFRB)
   04630 JAK-STAT signaling pathway
    711353 (PDGFRB)
   04020 Calcium signaling pathway
    711353 (PDGFRB)
   04072 Phospholipase D signaling pathway
    711353 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    711353 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    711353 (PDGFRB)
   04540 Gap junction
    711353 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    711353 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    711353 (PDGFRB)
   05206 MicroRNAs in cancer
    711353 (PDGFRB)
   05230 Central carbon metabolism in cancer
    711353 (PDGFRB)
   05231 Choline metabolism in cancer
    711353 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    711353 (PDGFRB)
   05218 Melanoma
    711353 (PDGFRB)
   05215 Prostate cancer
    711353 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    711353 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    711353 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    711353 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    711353 (PDGFRB)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     711353 (PDGFRB)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   711353 (PDGFRB)
CD molecules [BR:mcc04090]
 Proteins
  711353 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set C1-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 711353
NCBI-ProteinID: XP_001107595
Ensembl: ENSMMUG00000011557
UniProt: F7BTH1
LinkDB
Position
6
AA seq 1106 aa
MRLPGAMPALALKGQLLLLPLLLLLEPQVSQGLVITPPGPELILNVSSTFVLTCSGSAPV
VWERMSQELPQEMAKAQDNTFSSVLTLTNLTGLDTGEYFCTYNDSRGLEPDERKRLYIFV
PDPTMGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDIALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWMYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGALQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPMLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDMQEVIVVPHSLPFKAVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDSSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPEPQLERQV
EPEPELEQLPDSGCPAPRAEAEDSFL
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgcggcttccgggtgcgatgccagctctggccctcaaaggccagctgctgttgctgccc
ctgctgttactgctggaaccgcaggtctctcagggcctggtcatcacacccccggggcca
gagcttatcctcaatgtctccagcacctttgttctgacctgctcgggttcagctcccgtg
gtgtgggagcggatgtcccaggagctcccacaggaaatggccaaggcccaggacaatacc
ttctccagtgtgctgacactgaccaacctcactgggctagacacgggagaatacttttgc
acctacaatgactcccgtggactggagcctgatgagcggaaacggctctacatctttgtg
ccagatcccaccatgggcttcctccctaatgacgccgaggaactattcatctttcttacg
gaaataactgagatcaccattccatgccgagtaacagacccacaactggtggtgacactg
cacgagaagaaaggggacattgcactgcctgtcccctacgatcaccagcgtggcttttct
ggtatctttgaggacagaagctacatctgcaaaaccaccattggggacagggaggtggat
tccgacgcctactatgtctacagactccaggtgtcatccatcaacgtctccgtgaatgca
gtgcagacggtggtccgccagggtgagaacattaccctcatgtgcattgtgatcgggaat
gaggtggtcaacttcgagtggatgtacccccgcaaagaaagtgggcggctggtggagccg
gtgaccgacttcctcttggatatgccttaccacatccgctccatcctgcacatccccagt
gccgagttagaagactcggggacctacacctgcaatgtgacagagagtgtgaatgaccat
caggatgaaaaggccatcaacatcactgtggttgagagtggctacgtgcggctcctggga
gaggtgggagcactacaatttgctgagctgcaccggagccggacactgcaggtagtgttc
gaggcctaccctccgcccaccgtcctgtggttcaaagacaaccgcaccttgggcgactcc
agcgcaggcgagatcgccctgtccacgcgcaacgtgtcagagaccaggtatgtgtcagag
ctgacactcgttcgggtgaaggtggcagaggctggccactacaccatgcgggccttccat
gaggacgctgaggtccagctctccttccagctacagatcaatgtccctgtccgcgtgctg
gagctaagtgagagccacccagacagcggggaacagacagtccgctgtcgtggccggggc
atgccccagccgaacatcatctggtctgcctgcagagacctcaaaaggtgtccacgcgag
ctgccgcccatgctgctggggaacagttctgaagaggagagccagctggagacgaacgtg
acatactgggaggaggagcaggagtttgaggtggtgagcacactgcgtctgcagcacgtg
gatcggccactgtcggtgcgctgcacgctgcgcaacgctgtgggccaggacatgcaggag
gtcatcgtggtgccacactctttgcccttcaaggcggtggtgatctcagccatcctggcc
ctggtggtcctcaccatcatctcccttatcatcctcatcatgctttggcagaagaagcca
cgttacgagatccgatggaaggtgattgagtctgtgagctctgatggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacgtgggagctgccgcgggaccagctt
gtgctgggacgcaccctcggctctggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggccacgatgaaagtggccgtcaagatgcttaaatccacagcc
cgcagcagtgagaagcaagccctcatgtcggagctgaagatcatgagtcaccttgggccc
cacctgaacgtggtcaacctgttgggggcctgcaccaaaggaggacccatctatatcatc
actgagtactgccgctacggagacctggtggactacctgcaccgcaacaagcacacgttc
ctgcagcaccattccgacaagcgccgcccgcccagcgcggagctctacagcaatgcgttg
cccgttgggctccccctgcccagccacgtgtccctgactggggagagcgatggtggctac
atggacatgagcaaggacgagtcggtggactacgtgcccatgctggacatgaaaggagat
gtcaaatatgccgacatcgagtcctccaactacatggccccctacgataactacgttccc
tctgcccctgagaggacctgtcgagcaactttaatcaatgagtctccggtgctaagctac
atggaccttgtgggcttcagctaccaggtggccaatggcatggagttcctggcctccaag
aactgcgtgcaccgagacctggcggccaggaacgtgctcatctgcgagggcaagctggtc
aagatctgtgactttggcctggctcgagacatcatgcgggattcgaattacatctccaaa
ggcagtacctttttgcctttgaagtggatggctccagagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtccttcgggatcctgctctgggagatcttcactttgggt
ggcaccccttacccagagctgcccatgaatgagcagttctacaatgccatcaaacggggt
taccgcatggcccagcctgcccacgcctccgacgagatctatgagatcatgcagaagtgc
tgggaagagaagtttgagattcggccccctttctcccagctggtgctgcttctcgagaga
ctgttgggcgaaggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagt
gaccacccagccatccttcggtcccaggcccgcttgcctgggttccatggcctccgatct
cccctggacagcagctccgtcctctataccgccgtgcagcccaatgagggtgacaacgac
tatatcatccccctgcctgaccccaaacccgaggttgctgacgagggcccactggagggt
tcccccagcctagccagctccaccctgaatgaagtcaacacctcctcgaccatctcctgt
gacagccctctggagccccaggaggaaccagagccagagccccagcttgagcgccaggtg
gaaccagagccagagctggaacagctgccggattcagggtgccccgcgcctcgagcggaa
gcagaggacagcttcctgtag

DBGET integrated database retrieval system