KEGG   Macaca mulatta (rhesus monkey): 613028
Entry
613028            CDS       T01028                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8 precursor
  KO
K10030  interleukin 8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04062  Chemokine signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04218  Cellular senescence
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05134  Legionellosis
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05144  Malaria
mcc05146  Amoebiasis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05219  Bladder cancer
mcc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    613028 (CXCL8)
   04072 Phospholipase D signaling pathway
    613028 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    613028 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    613028 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    613028 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    613028 (CXCL8)
   04621 NOD-like receptor signaling pathway
    613028 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    613028 (CXCL8)
   04657 IL-17 signaling pathway
    613028 (CXCL8)
   04062 Chemokine signaling pathway
    613028 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    613028 (CXCL8)
   05202 Transcriptional misregulation in cancer
    613028 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    613028 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    613028 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    613028 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    613028 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    613028 (CXCL8)
   05135 Yersinia infection
    613028 (CXCL8)
   05133 Pertussis
    613028 (CXCL8)
   05134 Legionellosis
    613028 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    613028 (CXCL8)
   05171 Coronavirus disease - COVID-19
    613028 (CXCL8)
   05164 Influenza A
    613028 (CXCL8)
   05163 Human cytomegalovirus infection
    613028 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    613028 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    613028 (CXCL8)
   05144 Malaria
    613028 (CXCL8)
   05142 Chagas disease
    613028 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    613028 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    613028 (CXCL8)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Chemokines
   613028 (CXCL8)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Chemokines
   613028 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 613028
NCBI-ProteinID: NP_001028137
UniProt: P67813
LinkDB
Position
5
AA seq 101 aa
MTSKLAVALLAAFLLSAALCEGAVLPRSAKELRCECIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKEPWVQRVVEKFVKRAENQNP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggcggtggctctcttggcagccttcctgctttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttagatgtgagtgcataaagacgtac
tccaaacctttccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgtgccaatacagaaattattgtaaaactttccgatggaagagagctctgtctggacccc
aaggaaccatgggtgcagagggttgtggagaagtttgtgaagagggctgagaatcaaaat
ccataa

DBGET integrated database retrieval system