KEGG   Macaca mulatta (rhesus monkey): 613029Help
Entry
613029            CDS       T01028                                 

Gene name
GAD2, GAD65
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00250  Alanine, aspartate and glutamate metabolism
mcc00410  beta-Alanine metabolism
mcc00430  Taurine and hypotaurine metabolism
mcc00650  Butanoate metabolism
mcc01100  Metabolic pathways
mcc04727  GABAergic synapse
mcc04940  Type I diabetes mellitus
Module
mcc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    613029 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    613029 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    613029 (GAD2)
   00430 Taurine and hypotaurine metabolism
    613029 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    613029 (GAD2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    613029 (GAD2)
Enzymes [BR:mcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     613029 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 613029
NCBI-ProteinID: NP_001252783
Ensembl: ENSMMUG00000012233
UniProt: A0A1D5QBA0
LinkDB All DBs
Position
9
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSENGSGDSDNPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SQPPRVAARKAACACDQKPCSCPKADVNYGFLHATDLLPACDGERPTLAFLQDVMNILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMMIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccgggctctggcttttggtccttcgggtcggaaaatggctccggggattcc
gacaatcccggcacagcgcgagcctggtgccaagtggctcagaagttcacgggcggcatc
ggaaacaaactgtgcgccctgctctacggagacgccgagaagccggcggagagcggcggg
agccaacccccgcgggtcgccgcccggaaggccgcctgcgcctgcgaccagaagccctgc
agctgccccaaagcggatgtcaactacgggtttctccatgcaacagacctgctgccggcg
tgtgatggagaaaggcccactttggcgtttctgcaagatgttatgaacattttacttcag
tatgtggtgaaaagtttcgatagatcaaccaaagtgattgatttccattatcctaatgag
cttctccaagaatataattgggaattggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacaactctaaaatatgcaattaaaacagggcatcctagatacttcaat
caactttccactggattggatatggttggattagcagcagactggctgacatcgacagca
aatactaacatgttcacctatgaaattgctccagtatttgtgcttttggaatatgtcaca
ctaaagaaaatgagagaaatcattggctggccagggggctccggcgatgggatattttct
cccggtggcgccatatctaacatgtatgccatgatgatcgcgcgctttaagatgttcccg
gaagtcaaggagaaaggaatggctgctgttcccaggctcattgccttcacgtctgagcat
agtcatttttctctcaagaagggagctgcagccttagggattggaacagacagcgtgatt
ctgattaaatgtgatgagagagggaaaatgatcccatctgatcttgaaagaaggattctc
gaagccaaacagaaaggatttgttcctttcctcgtgagtgccacagctggaaccaccgtg
tatggagcatttgatccgctcttagctgtcgctgacatttgcaaaaagtataagatctgg
atgcacgtggatgcagcttggggtggaggattactgatgtcccgaaaacacaagtggaaa
ctgagtggcgtggagagggccaactctgtgacgtggaatccacacaagatgatgggagtc
cctttgcagtgttctgctctcctggttagagaagagggattgatgcagaattgcaaccaa
atgcatgcctcctacctctttcagcaagataaacattatgacctgtcctatgacactgga
gataaggccttacagtgtggacgccacgttgatgttttcaaactatggctgatgtggagg
gcaaaggggactaccgggtttgaagcacatgttgataaatgtttggagttggcagagtat
ttatacaacatcataaaaaaccgagaaggatatgagatggtgtttgatgggaagcctcag
cacacaaatgtctgcttctggtacattcctccgagcttgcgtactctggaagacaatgaa
gagagaatgagtcgcctctcaaaggtggctccagtgattaaggccagaatgatggagtat
ggaacaacaatggtcagctaccaacccttgggagacaaggtcaatttcttccgcatggtc
atctcaaaccctgcagcaactcaccaagacatcgacttcctgattgaagaaatagaacgt
cttggacaagatttataa

DBGET integrated database retrieval system