KEGG   Macaca mulatta (rhesus monkey): 613031
Entry
613031            CDS       T01028                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X2
  KO
K08774  transforming growth factor, alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04915  Estrogen signaling pathway
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05223  Non-small cell lung cancer
mcc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    613031 (TGFA)
   04012 ErbB signaling pathway
    613031 (TGFA)
   04014 Ras signaling pathway
    613031 (TGFA)
   04151 PI3K-Akt signaling pathway
    613031 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    613031 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    613031 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    613031 (TGFA)
   05212 Pancreatic cancer
    613031 (TGFA)
   05225 Hepatocellular carcinoma
    613031 (TGFA)
   05214 Glioma
    613031 (TGFA)
   05211 Renal cell carcinoma
    613031 (TGFA)
   05215 Prostate cancer
    613031 (TGFA)
   05223 Non-small cell lung cancer
    613031 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    613031 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 613031
NCBI-ProteinID: XP_002799317
Ensembl: ENSMMUG00000010591
UniProt: F7CHL7
LinkDB
Position
13
AA seq 159 aa
MVPSAGQLALFALGIVLAACQALENSTSLLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgcgctgggtattgtgttggcagcgtgc
caggccttggagaacagcacgtccctgctgagcgacccgcccgtggctgcagcagtggtg
tcccattttaatgactgcccagattcccacactcagttctgtttccatggaacctgcagg
tttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgttggtgcacgc
tgtgagcatgcggacctcctggctgtggtggccgccagtcagaagaagcaggccatcacc
gccttggtggtggtctccatcgtggccctggctgtccttatcatcacatgtgtgctgata
cactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcacgag
aagcccagcgccctcctaaagggaagaaccgcttgctgccactcagaaacagtggtctga

DBGET integrated database retrieval system