KEGG   Macaca mulatta (rhesus monkey): 613032
Entry
613032            CDS       T01028                                 

Gene name
HTR2A
Definition
(RefSeq) 5-hydroxytryptamine receptor 2A
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04540  Gap junction
mcc04726  Serotonergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    613032 (HTR2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    613032 (HTR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    613032 (HTR2A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    613032 (HTR2A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    613032 (HTR2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcc04030]
    613032 (HTR2A)
G protein-coupled receptors [BR:mcc04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    613032 (HTR2A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 613032
NCBI-ProteinID: NP_001028138
Ensembl: ENSMMUG00000004210
UniProt: P50128
LinkDB
Position
17
AA seq 471 aa
MDILCEENTSLSSTTNSLMQLNEDTRLYSNDFNSGEANTSDAFNWTVESENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
RDPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEDASKDNSDGVNEKVSCV
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggatattctttgtgaagaaaatacttctttgagctcaactacgaactccttaatgcaa
ttaaatgaagacaccaggctctacagtaatgactttaactccggagaagctaacacttct
gatgcatttaactggacagtcgagtctgaaaatcgaaccaacctttcctgtgaagggtgc
ctctcaccatcgtgtctctccttacttcatctccaggaaaaaaactggtctgctttattg
acagctgtagtgattattctaaccattgctggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggtttccttgtcatgcccgtgtccatgttaaccatcctgtatgggtaccgg
tggcctctgcccagcaagctttgcgcggtctggatttacctagacgtgctcttctccacg
gcctccatcatgcacctctgcgccatctcgctggaccgctatgtcgccatccagaatccc
atccaccacagccgcttcaactccagaactaaggcatttctgaaaatcattgctgtttgg
accatatcagtaggtatatcgatgccaataccagtctttgggctacaggacgattcgaag
gtctttaaggaggggagttgcttactcgccgatgataactttgtcttgatcggctctttt
gtgtcatttttcattcccttgaccatcatggtgatcacctactttctaactatcaagtca
ctccagaaagaagctactttgtgtgtaagtgatctcggcacacgggccaaattagcttct
ttcagcttcctccctcagagttctttgtcttcagaaaagctgttccagcggtcgatccac
agggacccagggtcctacacaggcagaaggactatgcagtccatcagcaatgagcaaaag
gcatgcaaggtgctgggtatcgtcttcttcctgtttgtggtgatgtggtgccctttcttc
atcacgaacatcatggccgtcatctgcaaagagtcttgcaatgaggatgtcattggggcc
ctgctcaatgtgtttgtttggatcggttatctctcttcagcagtcaacccactggtctac
acactgttcaacaagacttataggtcagccttttcacggtatattcagtgtcagtacaag
gaaaacaaaaaaccattgcagttaattttagtgaacactataccggctttggcctacaag
tctagccaacttcaaatgggacaaaaaaagaattcaaagcaagatgccaagacaacagat
aatgactgctcaatggttgctctaggaaagcagcattctgaagatgcttctaaagacaat
agcgacggagtgaatgaaaaggtgagctgtgtgtga

KEGG   Macaca mulatta (rhesus monkey): 708141
Entry
708141            CDS       T01028                                 

Gene name
HTR2C
Definition
(RefSeq) 5-hydroxytryptamine receptor 2C isoform X1
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04540  Gap junction
mcc04726  Serotonergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    708141 (HTR2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    708141 (HTR2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    708141 (HTR2C)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    708141 (HTR2C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    708141 (HTR2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcc04030]
    708141 (HTR2C)
G protein-coupled receptors [BR:mcc04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    708141 (HTR2C)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx DUF1385 UPF0182 Pox_P21
Other DBs
NCBI-GeneID: 708141
NCBI-ProteinID: XP_028697795
Ensembl: ENSMMUG00000009607
LinkDB
Position
X
AA seq 458 aa
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEDKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENAANPNQDQNARRRRKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIKKASDNEPGIEMQAENLELPVNPSSVVSERISSV
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggtgaacctgaggaacgcggtgcattcattccttgtgcacctaattggcctattggtt
tggcaatgcgatatttctgtcagcccagtagcagctatagtaactgacattttcaatacc
tccgatggtggacgcttcaaattcccagacggggtacaaaactggccagcactttcaatc
gtcgtaataataatcatgacaataggtggcaacatacttgtgatcatggcagtaagcatg
gaaaagaaactgcacaatgccaccaattacttcttaatgtccctagccattgctgatatg
ctagtgggactacttgtcatgcccctgtctctcctggcaatcctttatgattatgtctgg
ccactacctagatatttgtgccccgtctggatttctttagatgttttattttcaacagcg
tccatcatgcacctctgcgctatatcgctggatcggtatgtagcaatacgtaatcctatt
gagcatagccgtttcaattcgcggactaaggccatcatgaagattgctattgtttgggca
atttctataggtgtatcagttcctatccctgtgattggactgagggacgaagacaaggtg
ttcgtgaacaacacgacgtgcgtgctcaacgacccaaatttcgttcttattgggtccttc
gtagctttcttcataccgctgacgattatggtgattacctattgcctgacgatctacgtt
cttcgccgacaagctttgatgttactgcacggccacaccgaggaaccgcctggactaagt
ctggatttcctgaagtgctgcaagaggaatacggccgaggaagagaacgctgcaaaccct
aaccaagaccagaacgcacgccgaagaaggaagaaggagagacgtcctaggggcaccatg
caggctatcaacaatgaaagaaaagcttcgaaagtccttgggattgttttctttgtgttt
ctgatcatgtggtgcccatttttcattaccaatattctgtcggttctttgtgagaagtcc
tgtaaccaaaagctcatggaaaagcttctgaatgtgtttgtttggattggctatgtgtgt
tcaggaatcaatcctctggtgtatactctcttcaacaaaatttaccgaagggcattctcc
aactatttgcgctgcaattataaggtagagaaaaagcctcctgtcaggcaaattccaaga
gttgccgccactgctttgtcagggagggagcttaatgttaacatttatcggcataccaat
gaaccggtgatcaagaaagccagtgacaatgagcccggtatagagatgcaagctgagaat
ttagagttaccagtaaatccctccagtgtggttagcgaaaggattagtagtgtgtga

KEGG   Macaca mulatta (rhesus monkey): 711808
Entry
711808            CDS       T01028                                 

Gene name
HTR2B
Definition
(RefSeq) 5-hydroxytryptamine receptor 2B isoform X1
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04540  Gap junction
mcc04726  Serotonergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    711808 (HTR2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    711808 (HTR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    711808 (HTR2B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    711808 (HTR2B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    711808 (HTR2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcc04030]
    711808 (HTR2B)
G protein-coupled receptors [BR:mcc04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    711808 (HTR2B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srx MWFE
Other DBs
NCBI-GeneID: 711808
NCBI-ProteinID: XP_014966817
Ensembl: ENSMMUG00000011773
UniProt: F7HQF4
LinkDB
Position
12
AA seq 481 aa
MALSYRVSELQSTMPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPIPIKGIETDVDNPNNITCVLTKERFGNFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPRRLTWSTVSTVFQRDETPCSSPEKVAMLDGSRKDKALCNSSDER
LTRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
TAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggctctctcttacagagtgtctgaacttcaaagcacaatgcctgagcacattttgcag
agcacctttgttcacgttatctcttctaactggtctggattacagacagaatcaatacca
gaggaaatgaaacagattgttgaggaacagggaaataaactgcactgggcagctcttctg
atactcatggtgataatacccacaattggtggaaatacccttgttattctggctgtttcg
ctggagaaaaagctgcagtatgctactaattactttctaatgtccttggcggtggctgat
ttgctggttggattgtttgtgatgccaattgccctcttgacaataatgtttgaggctatg
tggcccctcccacttgttctatgtcctgcctggttattccttgacgttctcttttcaacc
gcatccatcatgcatctctgtgccatttcagtggatcgttatatagccatcaaaaaacca
atccaggccaatcaatataactcacgagctacagcattcatcaagattacagtggtgtgg
ttaatttcaataggcattgccattccaatccctattaaagggatagagactgatgtggac
aacccaaacaatatcacttgtgtgctgacaaaggaacgttttggcaatttcatgctcttt
ggctcactggctgccttctttacacctcttgcaattatgattgttacctactttctcact
atccatgctttacagaagaaggcttacttggtcaaaaacaagccacctcgacgcctaaca
tggtcaactgtgtctacagttttccaaagggatgaaacaccttgttcgtcaccagaaaag
gtggcaatgctggatggttctcgaaaggacaaggctctgtgcaactcaagtgatgaaaga
cttacgcgaagaacatccacaattggaaaaaagtcagtgcagaccatttccaatgaacag
agagcctcaaaagtcctagggattgtgtttttcctctttttgcttatgtggtgtcccttc
tttattacaaacataactttagttttatgtgattcctgtaaccaaactactctccaaatg
ctcctggagatatttgtgtggataggctatgtttcctcaggagtgaatcctttggtttac
accctcttcaataagacatttcgggatgcatttggccgatatataacctgcaattaccgg
gccacaaagtcagtaaaaactcttagaaaacgctccagtaagatctacttccggaatcca
acggcagagaactctaagtttttcaagaaacatggaattcgaaatgggattaatcctgcc
atgtaccagagtccaatgaggctccgaagttcaaccattcagtcttcatcaatcattcta
ctagatacacttctcctcactgaaaatgaaggtgacaaaactgaagagcaagttagttac
gtgtag

DBGET integrated database retrieval system