KEGG   Macaca mulatta (rhesus monkey): 613269
Entry
613269            CDS       T01028                                 

Gene name
FN1
Definition
(RefSeq) fibronectin isoform X1
  KO
K05717  fibronectin 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04810  Regulation of actin cytoskeleton
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05100  Bacterial invasion of epithelial cells
mcc05135  Yersinia infection
mcc05146  Amoebiasis
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    613269 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    613269 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    613269 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    613269 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    613269 (FN1)
   05205 Proteoglycans in cancer
    613269 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    613269 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    613269 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    613269 (FN1)
   05100 Bacterial invasion of epithelial cells
    613269 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    613269 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    613269 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    613269 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    613269 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    613269 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    613269 (FN1)
Membrane trafficking [BR:mcc04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    613269 (FN1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   613269 (FN1)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   613269 (FN1)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   613269 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369
Other DBs
NCBI-GeneID: 613269
NCBI-ProteinID: XP_014966387
Ensembl: ENSMMUG00000012321
LinkDB
Position
12
AA seq 2478 aa
MLRGPGPGLLLLAVLCLGTAVPSTGASKSKRQAQQMIQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALICTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTTVQTTSSGSGPFTDVREAVYQPQPHP
QPAPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCMCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVQVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHREVTRFDFTTTSTSTPVTSNTVTGETTPLSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYEISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIFAVEENQESTPVFIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVNHGRESKPLTAEQTTKLDAPTNLQFVNETDSTVLVRWTPP
RARITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPGSEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLETNPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHMSGRPREDRVPPS
RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVFAQNPNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQTPVQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSSPREVVP
RPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFITHPGYDTGNGIQLPGTSGQQPTVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGLGLNPNASTGQEALSQTTISWAPFQDT
SEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVT
VGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCHCLGFGSGHFRCDSSR
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTVSALVP
RVCSLILDSPFYRYLPSE
NT seq 7437 nt   +upstreamnt  +downstreamnt
atgctcaggggtccggggcccgggctgctgctgctggccgtcctgtgcctggggacagcg
gtgccctccacgggagcctcgaagagcaagaggcaggctcagcaaatgattcagccccag
tctccggtggctgtcagtcaaagcaagcccggttgttatgacaatggaaaacactatcag
ataaatcaacagtgggagcggacctacctgggcaatgccttgatttgtacttgttatgga
ggaagccgaggttttaactgcgagagtaaacctgaagctgaagagacttgctttgacaag
tacactgggaacacttaccgagtgggtgacacttatgagcgtcctaaagactccatgatc
tgggactgtacctgcatcggggctgggcgagggagaataagctgcaccatagcaaaccgc
tgccatgaagggggtcagtcctacaagattggtgacacctggaggagaccacacgagact
ggtggttacatgttagagtgtgtgtgtcttggtaatggaaaaggagaatggacctgcaag
cccatagctgagaaatgttttgatcatgctgctgggacttcctatgtggtcggagaaacc
tgggagaagccctaccaaggctggatgatggtagattgtacttgcctgggagaaggcagc
ggacgcatcacgtgcacctctagaaatagatgcaacgatcaggacacgaggacgtcctat
agaattggagacacctggagcaagaaggataatcgaggaaacctgctccagtgcatctgc
acaggcaacggccgaggagagtggaagtgtgagaggcacaccactgtgcagaccacatcg
agcggatctggccccttcaccgatgttcgtgaagctgtttaccaaccgcagcctcacccc
cagcctgccccctatggccactgtgtcacagacagtggtgtggtctactctgtggggatg
cagtggctgaagacacaaggaaataagcaaatgctttgcatgtgcctgggcaatggagtc
agctgccaagagacagctgtaacccagacttatggtggcaactcaaatggagagccatgt
gtcttaccattcacctacaatggcaggacgttctactcctgcaccacagaagggcgacag
gacggacatctctggtgcagcacaacttcgaattatgagcaggaccagaaatattctttc
tgcacagaccatactgttttggttcagactcgaggaggaaattccaatggtgccttgtgc
cacttccccttcctatacaacaaccacaattacactgattgcacttctgagggcagaagg
gacaacatgaagtggtgtgggaccacacagaactatgatgccgaccagaagtttggattc
tgccccatggctgcccatgaggaaatctgcacaaccaatgaaggggtcatgtaccgcatt
ggagatcagtgggataagcagcatgacatgggccacatgatgaggtgcacgtgtgttggg
aacggtcgtggggaatggacatgcattgcctactcgcagcttcgagatcagtgcattgtt
gatgacatcacttacaatgtgaatgacacattccacaagcgtcatgaagagggacacatg
ctgaactgtacatgcttcggtcagggtcggggtagatggaagtgtgatcccgtcgaccaa
tgccaggattcagagactgggacattttatcaaattggagattcatgggagaagtatgtg
catggtgtcagataccagtgctactgctatggccgtggcattggggagtggcattgccaa
cctttacagacctatccaagctcaagtggtcctgtccaagtatttatcactgagactccg
agtcagcccaactctcaccccatccagtggaatgcaccacagccgtctcacatttccaag
tacattctcaggtggaggcctaaaaattctgtaggccgttggaaggaagctaccatacca
ggccacttaaactcctacaccatcaaaggcctgaagcctggtgtggtatacgagggccag
ctcatcagcatccagcagtacggccaccgagaagtgactcgctttgacttcaccaccacc
agcaccagcacacctgtgaccagcaacaccgtgacaggagagacaactcccctttctccc
cttgtggccacttctgaatctgtcactgaaatcacagccagcagctttgtggtctcctgg
gtctcagcttccgacactgtgtcaggattccgggtggaatatgagctgagtgaggaggga
gacgagccacagtatctggatcttccaagcacagccacttccgtgaacatccctgacctg
cttcctggccgaaaatacattgtaaatgtctatgagatatctgaggatggggagcagagt
ttgatcctgtctacttcacaaacaacagcgcccgatgcccctcctgacccgactgtggac
caagttgatgacacctcaattgttgttcgctggagcagaccccaggctcccatcacaggg
tacagaatagtctattcaccgtcagtagaaggcagcagcacagaactcaaccttcctgaa
actgcaaactccgtcaccctcagtgacttgcaacctggcgttcagtataacatcactatc
tttgccgtggaagaaaatcaagaaagtacacctgttttcattcaacaagaaaccactggc
accccacgttcagatacagtgccctctcccagggacctgcagtttgtggaagtgacagac
gtgaaggtcaccatcatgtggacaccgcctgagagtgcagtgactggctaccgcgtggat
gtgatccccgtcaacctgcctggggagcacgggcagaggttgcccatcagcaggaacacc
ttcgcagaagtcaccgggctgtcccctggggtcacctattacttcaaagtctttgccgtg
aaccacgggagggagagcaagcctctgactgccgaacagacaaccaaactggatgctccc
actaacctccagtttgtcaatgaaacggattctactgtcctggtgagatggactccacct
cgggcccggataacaggataccgactgactgtgggcctgacccgaagaggccagcccagg
cagtacaatgtgggtccctctgtctcgaagtacccactgaggaatctgcagcctggatca
gagtacaccgtatcccttgtggccataaagggcaaccaagagagccccaaagccactgga
gtctttaccacactgcagcctgggagctccattccaccttacaacacggaggtgaccgag
accaccattgtgatcacatggacacctgctccaagaattggttttaagctgggtgtacga
ccaagccagggaggagaggcaccacgagaagtgacttcagactcaggaagcatcgttgtg
tctggcttgactccaggagtggaatatgtctacaccatccaagtcctgagagacggacag
gaaagagatgcgccaattgtaaacaaagtggtgacaccattgtctccaccaacaaacttg
catctggagacaaaccctgacactggagtgctcacagtctcctgggagaggagtaccacc
ccagacattactggttatagaattaccacaacccctacaaacggccagcagggatattct
ttggaagaagtggtccatgctgatcagagctcctgcacttttgataacctgagtcccggc
ctggagtacaatgtcagtgtttacactgtcaaggatgacaaggaaagtgtccctatctct
gataccatcatcccagaggtgccccaactcactgacctaagctttgttgatataaccgat
tcaagcatcggcctgaggtggaccccgctaaactcttccaccattattgggtaccgcatc
acagtagttgcggcaggagaaggtatccctatttttgaagattttgtggactcctcagta
ggatactacacagtcacagggctggagccgggcattgactatgatatcagcgttatcact
ctcattaatggcggcgagagtgcccctactacactgacacaacaaacggctgttcctcct
cccactgacctgcgattcaccaacattggtccagacaccatgcgtgtcacctgggctcca
cccccatccattgatttgaccaacttcctggtgcgttactcacctgtgaaaaatgaggaa
gatgttgcagagttgtcaatttctccttcagacaatgcagtggtcttaacaaatctcctg
cctggtacagaatatgtagtgagtgtctccagtgtctacgaacaacacgagagcacacct
cttagaggaagacagaaaacaggtcttgattccccaactggcattgacttttctgatatt
actgccaactcttttactgtgcactggattgctcctcgagccaccatcactggctacagg
atccgccatcaccccgagcacatgagcgggagacctcgagaagatcgggtgcccccctct
cggaattccatcaccctcaccaacctcactccaggcacagagtatgtggtcagcatcgtt
gctcttaatggcagagaggaaagtcccttattgattggccaacaatcaacagtttctgat
gttccgagggacctggaagttgttgctgcgacccccaccagcttgctgatcagctgggat
gctcctgctgtcactgtgagatattacaggatcacttatggagaaacaggaggaaatagc
cctgtccaggagttcactgtgcctgggagcaagtctacagctaccatcagtggccttaaa
cctggagtcgattataccatcactgtgtatgctgtcactggccgtggagacagccccgca
agcagcaagccaatttccattaattaccgaacagaaattgacaaaccatcacagatgcaa
gtgaccgatgttcaggacaacagcattagtgtcaagtggctgccttcaagttcccctgtt
actggttacagagtaaccaccactcccaaaaatggaccaggaccaacaaaaactaaaact
gcaggtccagatcaaacagaaatgactattgaaggcttgcagcccacagtggagtatgtg
gttagtgtctttgctcagaatccaaacggagagagtcagcctctggttcagactgcagta
accaacattgatcgccctaaaggactggcattcactgatgtggatgtcgattccatcaaa
attgcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagccct
gaggatggaatccatgagctattccctgcacctgatggtgaagaagacactgcagagctg
caaggcctcagaccgggttctgagtacacagtcagtgtggttgccttgcacgatgatatg
gagagccagcccctgattggaacccagtccacagctattcctgcaccaactgacctgaag
ttcactcaggtcacaccaacgagcctgagcgcccagtggacaccacccaatgttcagctc
actggatatcgagtgcgggtgacccccaaggagaaaaccggaccaatgaaagaaatcaac
cttgctcctgacagctcatccgtggttgtatcaggacttatggtggccaccaaatatgaa
gtgagtgtctatgctcttaaggacactctgacaagcagaccagctcagggagttgtcacc
actctagagaatgtcagcccaccaagaagggctcgtgtgacagatgctactgagaccacc
atcaccattagctggagaaccaagaccgagacgatcactggcttccaagttgatgctgtt
ccagccaatggccagactccagtccagagaaccatcaagccagatgtcagaagctacacc
atcacaggtttacaaccaggcactgactacaagatctacctgtacaccctgaacgacaat
gcccggagctcccctgtggtcatcgacgcctccactgccattgatgcaccatccaacctg
cgtttcctggccaccacacccaattccttgctggtatcgtggcagccgccacgtgccagg
atcaccggctacatcatcaagtatgagaagcctgggtcttctcccagagaagtggtccct
cggccccgccctggtgtcacagaggctactattactggcctggaaccgggaaccgaatat
accatttatgtcattgccctgaagaataatcagaagagcgagcccctgattggaaggaaa
aagacagacgagcttccccaactggtaacccttccacaccccaatcttcatggaccagag
atcttggatgttccttccacagttcaaaagacccctttcatcacccaccctgggtatgac
actggaaatggtattcagcttcctggcacttctggtcagcaacccactgttgggcaacaa
atgatctttgaggaacatggttttaggcggaccacacctcccacaacagccacccccata
aggcataggccaagaccatacccgccgaatgtaggtgaggagattcaaattggtcacatc
cccagggaagacgtagactatcacctctacccacatgggctgggactcaatccaaatgcc
tctacaggacaagaagctctctctcagacaaccatctcatgggccccattccaggacact
tctgagtacatcatttcatgtcatcctgttggcactgacgaagagcccttacagttcagg
gttcctggaacttctaccagtgccactctgacaggcctcaccagaggtgccacctacaac
atcatagtggaggcactgaaagaccagcagaggcataaggttcgggaagaggttgttacc
gtgggcaactctgtcaatgaaggcttgaaccaacctacggatgactcatgctttgacccc
tacacggtttcccattacgccgttggagatgagtgggaacgaatgtctgaatcaggcttt
aaactgttgtgccactgcttaggctttggaagtggtcatttcagatgtgattcatctaga
tggtgccatgacaatggtgtgaactacaagattggagagaagtgggaccgtcagggagaa
aatggccagatgatgagctgcacgtgtcttgggaatggaaaaggagaattcaagtgtgac
cctcatgaggcaacgtgttatgatgatgggaagacgtaccacgtaggagaacagtggcag
aaggaatatctcggtgccatttgctcctgcacatgctttggaggccagcggggctggcgc
tgtgacaactgccgcagacctgggggtgaacccagtcccgaaggcactactggtcagtcc
tacaaccagtattctcagagataccatcaaagaacaaacactgtaagtgcattggtgcca
cgagtgtgttccctcatactagacagtcctttctacaggtatcttccttcagaatga

DBGET integrated database retrieval system