KEGG   Macaca mulatta (rhesus monkey): 677689
Entry
677689            CDS       T01028                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04380  Osteoclast differentiation
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04621  NOD-like receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc05140  Leishmaniasis
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05212  Pancreatic cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    677689 (JAK1)
   04151 PI3K-Akt signaling pathway
    677689 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    677689 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    677689 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    677689 (JAK1)
   04658 Th1 and Th2 cell differentiation
    677689 (JAK1)
   04659 Th17 cell differentiation
    677689 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    677689 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    677689 (JAK1)
   05203 Viral carcinogenesis
    677689 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    677689 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    677689 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    677689 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    677689 (JAK1)
   05161 Hepatitis B
    677689 (JAK1)
   05160 Hepatitis C
    677689 (JAK1)
   05171 Coronavirus disease - COVID-19
    677689 (JAK1)
   05164 Influenza A
    677689 (JAK1)
   05162 Measles
    677689 (JAK1)
   05168 Herpes simplex virus 1 infection
    677689 (JAK1)
   05163 Human cytomegalovirus infection
    677689 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    677689 (JAK1)
   05169 Epstein-Barr virus infection
    677689 (JAK1)
   05165 Human papillomavirus infection
    677689 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    677689 (JAK1)
   05140 Leishmaniasis
    677689 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    677689 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    677689 (JAK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     677689 (JAK1)
Protein kinases [BR:mcc01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   677689 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2
Other DBs
NCBI-GeneID: 677689
NCBI-ProteinID: NP_001244838
Ensembl: ENSMMUG00000018566
UniProt: F6YLX1
LinkDB
Position
1
AA seq 1154 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEVPEPGVEVIFYMSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDSGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQGQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRIFKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
SFQNLIEGFEALLK
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgaggtgaacctggaggtccctgagccaggggtggaagtgatcttc
tatatgtcggacagggagcccctccggctgggcagtggagagtatacagcagaggaactg
tgcatcagggctgcacaggcatgccgtatctctcctctttgtcacaacctctttgccctg
tatgatgagaacaccaagctctggtatgctccaaatcgcactatcaccgttgatgacaag
atgtccctccgactccactaccggatgaggttctatttcaccaattggcacggaaccaac
gacaatgagcagtcagtgtggcgtcattctccaaagaagcagaaaaatggctacgagaaa
aaaaaggttccagatgcaacccctctccttgatgccagctcactggagtatctgtttgct
cagggacagtatgatttggtgaaatgcctggctcccattcgagaccccaagaccgagcag
gatgggcatgatattgaaaacgagtgtctggggatggctgtcctggccatctcacactat
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctaaaggaatttaacaacaagaccatttgtgacagcagc
gtgtccacgcatgacctgaaggtgaaatacttggctaccttggaaactttgacaaaacat
tatggcgctgaaatatttgagacttccatgttgctgatttcatcagaaaatgagatgaat
tggtttcattcgaatgacagtggaaacgttctgtactatgaagtgatggtgactgggaat
cttggaatccagtggaggcataaaccaaatgttgtttctgttgaaaaggaaaaaaataaa
ctgaagcggaaaaaactggaaaataaacacaagaaggatgaggagaaaaacaagatccgg
gaagagtggaataatttttcttacttccctgaaatcactcacattgtaataaaggagtct
gtggtcagcattaacaagcaggacaacaagaaaatggaactgaagctgtcttcccatgag
gaggccttgtcctttgtgtcactggtagatggctacttccggctcaccgcagacgcccat
cattacctctgcaccgacgtggcccccccgttgatcgtccacaacatacagaatggctgt
catggtccaatctgtacagaatatgccatcaataaattgcggcaagaaggaagcgaggag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgctttgagaagtctgagcaggggcagggtgcccagaagcagttcaagaactttcagatc
gaggtgcagaagggccgctacagcctgcatggttcagaccgcagcttccccagcttggga
gacctcatgagccacctcaagaagcagatcctgcgcacggataacatcagcttcatgttg
aaacgctgctgccagcccaagccccgagaaatctccaacctgctggtggctactaagaaa
gcccaggagtggcagcccgtctaccccatgagccagctgagttttgatcggattttcaag
aaggatctggtgcagggcgagcaccttgggagaggcacgagaacacacatctactctggg
accctgatggattacaaggatgacgaaggaacttctgaagagaagaagataaaagtgatc
ctcaaagtcttagaccctagccacagggatatttccctggccttcttcgaggcagccagc
atgatgagacaggtctcccacaaacacatcgtgtacctctatggcgtctgtgtccgcgac
gtggagaatatcatggtggaagagtttgtggaagggggtcctctggatctcttcatgcac
cggaaaagcgatgtccttactacaccctggaaattcaaagttgccaaacagctggccagt
gccctgagctacttggaagataaagacctggtccatggaaatgtgtgtactaaaaacctc
ctcctggcccgtgagggcatcgacagcgagtgtggtccgttcatcaagctcagtgaccct
ggcatccccattacggtgctgtctaggcaagagtgcattgaacgaatcccgtggattgct
cccgagtgtgttgaggactccaagaacctgagtgtggctgctgacaagtggagctttgga
actacgctctgggaaatctgctacaatggcgagatccccttgaaagacaagacactgatt
gagaaagagagattctatgaaagccggtgcaggccagtgacaccatcatgtaaggagctg
gctgacctcatgacccgctgcatgaactacgaccccaatcagaggcccttcttccgagcc
atcatgagagacattaataagcttgaagagcagaatccagatattgtttcagaaaaaaag
ccagcaactgaagtggaccccacgcattttgagaagcgcttcctaaagaggatccgtgac
ttgggagagggccactttgggaaggttgagctctgcaggtatgaccccgaaggggacaat
acaggggagcaggtggctgtcaaatctctgaagcctgagagtggaggtaaccacatagct
gatctgaaaaaggaaatcgagatcttaaggaacctctatcatgagaacattgtgaagtac
aaaggaatctgcacggaagacggaggaaatggtattaagctcatcatggaatttctgcct
tcgggaagccttaaggagtatcttccaaagaataagaacaaaattaacctcaaacagcag
ctaaaatatgccgttcagatttgtaaggggatggactatttgggttctcggcaatatgtt
caccgtgacttggcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattgga
gacttcggtttaaccaaagcaattgaaaccgataaggagtattacaccgtcaaggatgac
cgggacagccctgtgttttggtatgctccagaatgtttaatgcaatctaaattttatatc
gcctctgacgtctggtcttttggagtcactctgcatgagctgctgacttactgtgactca
gattctagtcccatggctttgttcctgaaaatgataggcccaacccatggccagatgaca
gtcacaagacttgtgaatacattaaaagaaggaaaacgcctgccgtgcccgcctaactgt
ccagatgaggtttatcaacttatgaggaaatgctgggaattccaaccatccaatcggaca
agctttcagaaccttattgaaggatttgaagcacttttaaaataa

KEGG   Macaca mulatta (rhesus monkey): 694184
Entry
694184            CDS       T01028                                 

Gene name
JAK2
Definition
(RefSeq) tyrosine-protein kinase JAK2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04062  Chemokine signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04630  JAK-STAT signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04725  Cholinergic synapse
mcc04917  Prolactin signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc05140  Leishmaniasis
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05164  Influenza A
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05200  Pathways in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    694184 (JAK2)
   04151 PI3K-Akt signaling pathway
    694184 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    694184 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    694184 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    694184 (JAK2)
   04659 Th17 cell differentiation
    694184 (JAK2)
   04062 Chemokine signaling pathway
    694184 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    694184 (JAK2)
   04917 Prolactin signaling pathway
    694184 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    694184 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    694184 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    694184 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    694184 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    694184 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    694184 (JAK2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    694184 (JAK2)
   05164 Influenza A
    694184 (JAK2)
   05168 Herpes simplex virus 1 infection
    694184 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    694184 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    694184 (JAK2)
   05140 Leishmaniasis
    694184 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    694184 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    694184 (JAK2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     694184 (JAK2)
Protein kinases [BR:mcc01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   694184 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 RIO1 Kinase-like
Other DBs
NCBI-GeneID: 694184
NCBI-ProteinID: NP_001252830
Ensembl: ENSMMUG00000014558
UniProt: A0A5F8ATC5
LinkDB
Position
15
AA seq 1132 aa
MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKENDQTPLAIYNSISYKTFLPECIRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSDESRVVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPTVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGIRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSKLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWA
MHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAEL
ANLINNCMDYEPDFRPSFRAVIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNLRPSFRDLALRVDQIRDNMAG
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgggaatggcctgccttactatgacagaaatggagggaacatccacatcttctatatat
cagaatggtgatatttctggaaatgccaattctatgaagcaaatagatccagtccttcag
gtgtatctttaccattcccttgggaaatctgaggcagattatctgacctttccatctggg
gagtatgttgcagaagaaatctgtattgctgcttctaaagcttgtggtatcacacctgtg
tatcataatatgtttgctttaatgagtgaaacagaaaggatctggtatccacccaaccat
gtcttccatatagatgagtcaaccaggcataatgtactctacagaataagattttacttt
cctcgttggtattgcagcggcagcaacagagcctatcggcatggaatatctcgaggtgct
gaagctcctcttcttgatgactttgtcatgtcttacctctttgctcagtggcggcatgat
tttgtgcatggatggataaaagtacctgtgactcatgaaacacaggaagaatgtcttggg
atggcagtgttagatatgatgagaatagccaaagaaaatgatcaaaccccactggccatc
tataattctatcagctacaagacattcttaccagaatgtattcgagcaaagatccaagac
tatcatattttgacaaggaagcgaataaggtacagatttcgcagatttattcagcagttc
agccaatgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaacc
ctgcagtctgccttctacacagagaaatttgaagtaaaagaacctggaagtggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgagacactgacagaacaggatttacagttatattgcgatttt
cctaatattattgatgtcagtattaagcaagcaaaccaagagggttcagatgaaagccga
gttgtaactatccataagcaagatggtaaaaatctggaaattgaacttagctcattaagg
gaagctttgtctttcgtgtcattaattgatggatattatagattaactgcagatgcacat
cattacctctgtaaagaagtagcacctccaacagtgcttgaaaatatacaaagcaactgt
catggcccaatttcgatggattttgccattagtaaactgaagaaagcaggtaatcagact
ggactgtatgtacttcgatgcagtcctaaggactttaataaatattttctgacttttgct
gtcgagcgagaaaatgtcattgaatataaacactgtttgattacaaaaaatgagaatgaa
gagtacaacctcagtgggacaaagaagaacttcagcagtcttaaagatcttttgaattgt
taccagatggaaaccgttcgctcagacaatataattttccagtttactaagtgctgtccc
ccaaagccaaaagataaatcaaaccttctagtcttcagaacgaatggtgtttctgatgta
ccaacctcaccaacattacagaggcctactcatatgaaccaaatggtgtttcacaaaatc
agaaatgaagatttgatatttaatgaaagccttggccaaggcactttcacaaagattttt
aaaggcatacgaagagaagtaggagactatggtcaacttcatgaaacagaagttctttta
aaagttctggataaagcacatagaaactattcagagtctttctttgaagcagcaagcatg
atgagcaagctttctcacaagcatttggttttaaattatggagtatgtgtctgtggagag
gagaatattctggttcaggagtttgtaaaatttggatcactagatacatacctgaaaaag
aataaaaattgtataaatatattatggaaacttgaagttgcgaaacagttggcatgggcc
atgcattttctagaagaaaacacccttattcatgggaatgtgtgcgccaaaaatattcta
cttatcagagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatcct
ggcattagtattacagttttgccaaaggacattcttcaggagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaaatttaaatttggcaacagacaaatggagttttggt
accactttgtgggaaatctgcagtggaggagataaacctctaagtgccctggattctcaa
agaaagctgcaattttatgaagataggcaccagcttcctgcaccaaagtgggcagaatta
gcaaaccttataaataattgtatggattatgaacccgatttcaggccttctttcagagcc
gtcatacgagatcttaacagtttgtttactccagattatgaactattaacagaaaatgac
atgttaccaaatatgaggataggtgccctagggttttctggtgcctttgaagacagggat
cctacacagtttgaagagagacatttgaaatttctacagcaacttggcaagggtaacttt
gggagtgtggagatgtgccggtatgaccctctacaggacaacactggggaggtggtggct
gtaaaaaagcttcagcatagtactgaagagcacctgagagactttgaaagggaaattgaa
atcctgaaatccctacagcatgacaacattgtaaagtacaagggagtgtgctacagtgct
ggtcggcgtaatctaaaattaattatggaatatttaccatatggaagtttacgagactat
cttcaaaaacataaagaacggatagatcacaaaaaacttctgcagtacacatctcagata
tgcaagggtatggagtatcttggtacaaaaaggtatatccacagggatctggcaacaaga
aatatattggtggagaatgagaacagagttaaaattggagattttgggttaaccaaagtc
ttgccacaagacaaagaatactataaagtaaaagaacctggtgaaagtcccatattctgg
tatgctccagaatcactgacagagagcaagttttctgtggcctcagatgtttggagcttt
ggagtggttctgtatgaacttttcacatacattgagaagagtaaaagtccaccagcggaa
tttatgcgcatgattggcaatgataaacaaggacagatgatcgtgttccatttgatagaa
cttttgaagaataatggaagattaccaagaccagatggatgcccagatgagatttatatg
atcatgacagaatgctggaacaataatgtaaatctacgcccctcctttagagatctagct
cttcgagtggatcaaataagggataacatggctggatga

DBGET integrated database retrieval system