KEGG   Macaca mulatta (rhesus monkey): 693443
Entry
693443            CDS       T01028                                 

Gene name
APC
Definition
(RefSeq) adenomatous polyposis coli protein isoform X1
  KO
K02085  adenomatosis polyposis coli protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04310  Wnt signaling pathway
mcc04390  Hippo signaling pathway
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04810  Regulation of actin cytoskeleton
mcc04934  Cushing syndrome
mcc05010  Alzheimer disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05213  Endometrial cancer
mcc05217  Basal cell carcinoma
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    693443 (APC)
   04390 Hippo signaling pathway
    693443 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    693443 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    693443 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    693443 (APC)
   05206 MicroRNAs in cancer
    693443 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    693443 (APC)
   05225 Hepatocellular carcinoma
    693443 (APC)
   05226 Gastric cancer
    693443 (APC)
   05217 Basal cell carcinoma
    693443 (APC)
   05213 Endometrial cancer
    693443 (APC)
   05224 Breast cancer
    693443 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    693443 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    693443 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    693443 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    693443 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    693443 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    693443 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    693443 (APC)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     693443 (APC)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    693443 (APC)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     693443 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_rep APC_u15 APC_u9 SAMP Arm APC_u13 APC_15aa Suppressor_APC
Other DBs
NCBI-GeneID: 693443
NCBI-ProteinID: XP_014996059
Ensembl: ENSMMUG00000000330
LinkDB
Position
6
AA seq 2871 aa
MYASLGSGPVAALPVSVPPSTLRSWSTGGSRSCVRQETKSPGGARTSGHWASVWQEVLKQ
LQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGEC
SPVPMGSFPRRGFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRID
SLPLTENFSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILR
IRQLLQSQATEAERSSQNKHETGSHDAERQNEGQGVAEINMATSGNGQGSTTRMDHETAS
VLSSSSTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQS
GCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLL
EQIRAYCETCWEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELG
RKATRGISSQELGQGLSGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGD
VANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKAL
MECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAII
ESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNP
KDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSL
HVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQSLYGDYVFDTNRHEDNRSD
NFNAGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGIGLGNYHPATENPGT
SSKRGLQISTTAAQIAKVMEEVSAIHTSQEDRSSGSTTELHCVTDERNALRRSSAAHTHS
NTYNFTKSENSNRTCSMPYAKLEYKRSSNDSLNSVSSSDGYGKRGQMKPSIESYSEDDES
KFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARP
KHIIEDEIKQSEQRQSRSQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANSSET
NRVGSNHGINQNVSQSLCQEDDYEDDKPTNYSERYSEEEQHEEEERPTNYSIKYNEEKHH
VDQPIDYSLKYATDIPSSQKQSFSFSKSSSGQSTKTEHISSSSENTSTPSSNAKRQNQLH
PSSAQSRSGQTQKAATCKVSSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCDQT
TQEADSANTLQIAEIKDKIGTRSTEDPVSEVPAVSQHTRTKSSRLQGSSLSSESTRHKAV
EFSSGAKSPSKSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSFESRSIASSVQSEPCSG
IVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTAQTKREVPKNKTPTAEKRESGPKQAAV
NAAVQRVQVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQEND
NGNETESEQPKESNENQEKEAEKTIDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAK
KPAQTASKLPPPVARKPSQLPVYKLLPSQNRLQPQKHVSFTPGDDMPRVYCVEGTPINFS
TATSLSDLTIESPPNELAAGEGVRAGAQSGEFEKRDTIPTEGRSTDEAQGGKTSSVTIPE
LDDNKAEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQQASASSSATNKNQLDGKKKKP
TSPVKPIPQNTEYRTRIRKNADSKNNLNAERVFSDNKDSKKQNLKNNSKDFNDKLPNNED
RVRGSFAFDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKAKENKESEA
KVTSHTELTSNQQSASKTQAIAKHPINRGQLKPILQKQSTFPQSSKDIPDRGAATDEKLH
NFAIENTPVCFSHNSSLSSLSDIDQENNNNKENEPIKETEPPDSQGEPSKPQASGYAPKS
FHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKKKKPSRLKGDNEKHSPRNMGGM
LAEDLTLDLKDIQRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSD
SDSILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRILKPGEKSTLETKKIESESKGIKGG
KKVYKSLITGKVRSNSEISGQMKQPLQANMPSISRGRTMIHIPGVRNSSSSTSPVSKKGP
PLKTPASKSPSEGQTATTSPRGAKPSVKSELSPVARQTSQIGGSSKAPSRSGSRDSTPSR
PAQQPLSRPIQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGR
QMSQQNLTKQTGLSKNASSIPRSESASKGLNQVNNGNGANKKVELSRMSSTKSSGSESDR
SERPVLVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPASPTRSQAQTPVLSPSLPDM
SLSTHSSVQAGGWRKLPPNLSPTIEYNDGRPAKRHDIARSHSESPSRLPINRSGTWKREH
SKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSISGTKQSKENQVSAKGT
WRKIKENEISPTNSTSQTVSSGATNGAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRS
GRSPTGNTPPVIDSVSEKGNPNKDSKDNQAKQNVGNGSVPMRTVGLENRLNSFIQVDAPD
QKGTETKPGQNNPVPVSETNESSIVERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRK
SSADSTSARPSQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTSV
NT seq 8616 nt   +upstreamnt  +downstreamnt
atgtacgcctccctgggctcgggtccggtcgctgctttgcccgtttctgtaccaccctca
actctccggtcctggagcaccggcggcagcaggagctgcgtccggcaggagacgaaaagc
ccaggcggcgctcgtacttctggccactgggcgagcgtctggcaggaagtacttaaacaa
ctacaaggaagtattgaagatgaagctatggcttcttctggacagattgatttattagag
cgtcttaaagagcttaacttagatagcagtaatttccctggagtaaaactacggtcaaaa
atgtccctccgttcttatggaagccgggaaggatctgtatcaagccgttctggagagtgc
agtcctgttcctatgggttcatttccaagaagagggtttgtaaatggaagcagagaaagt
actggatatttagaagaacttgagaaagagaggtcgttgcttcttgctgatcttgacaaa
gaagaaaaggaaaaagactggtattatgctcaacttcagaatctcactaaaagaatagat
agtcttcctttaactgaaaatttttccttacaaacagatatgaccagaagacaattggaa
tatgaagcgaggcaaatcagagttgcaatggaagaacaactaggtacctgccaggatatg
gaaaaacgagcacagagaagaatagccagaattcagcaaattgaaaaggacatacttcgt
atacgacagcttttacagtcccaagcaacagaagcagagaggtcatctcagaacaagcat
gaaaccggctcacatgatgctgagcggcagaatgaaggtcaaggagtggcagaaatcaac
atggcaacttctggtaatggtcagggttcaactacacgaatggaccacgaaacagccagt
gttttgagttctagtagcacacactctgcacctcgaaggctgacaagtcatctgggaacc
aaggtggaaatggtgtattcattgttgtcaatgcttggtactcatgataaggatgatatg
tcgcgaactttgctagctatgtctagctcccaagacagctgtatatccatgcgacagtct
ggatgtcttcctctcctcatccagcttttacatggcaatgacaaagactctgtattgttg
ggaaattcccggggcagtaaagaggctcgggccagggccagtgcagcactccacaacatc
attcactcacagcctgatgacaagagaggcaggcgtgaaatccgagtccttcatcttttg
gaacagatacgtgcttactgtgaaacctgttgggagtggcaggaagcccatgaacaaggc
atggaccaggacaaaaacccaatgccagcacctgttgaacatcagatctgtcctgctgtg
tgtgttctaatgaaactttcatttgatgaagagcatagacatgcaatgaatgaactaggt
aggaaggctacccggggcatttcatcacaggagctagggcaggggctttcagggggacta
caggccattgcagaattattgcaagtggactgtgaaatgtatgggcttactaatgaccac
tacagtattacactaagacgatatgctggaatggctttgacaaacttgactttcggagat
gtagccaacaaggctacactatgctctatgaaaggctgcatgagagcacttgtggcccaa
ctaaaatctgaaagtgaagacttacagcaggttattgcaagtgttttgcggaatttgtct
tggcgagcagatgtaaatagtaaaaagacgttgcgggaagtcggaagtgtgaaagcattg
atggaatgtgctttagaagttaaaaaggaatcaaccctcaaaagcgtattgagtgcctta
tggaatttgtcagcacattgcactgagaataaagctgatatatgtgctgtagatggtgca
cttgcatttttggttggcactcttacttaccggagccagacaaacactttagccattatt
gaaagtggaggtgggatattacggaatgtgtccagcttgatagctacaaatgaggaccac
aggcaaattctaagagagaacaactgtctacagactttattacaacacttaaaatctcat
agtttgacaatagtcagtaatgcttgtggaactttgtggaatctctcagcaagaaatcct
aaagaccaggaagcattatgggacatgggggcagttagcatgctcaagaacctcattcat
tcaaagcacaaaatgattgctatgggaagtgctgcagctttaaggaatctcatggcaaat
aggcctgcgaagtacaaggatgccaatattatgtctcctggctcaagcttgccatctctt
catgttaggaaacaaaaagccctagaagcagaattagatgctcagcatttgtcagaaact
tttgacaatatagacaatttaagtcccaaggcatctcatcgtagtaagcaaagacacaag
caaagtctctatggtgattatgtttttgacaccaatcgacatgaagataataggtcagac
aattttaatgctggcaacatgactgtcctttcaccatatttgaatactacagtgttaccc
agctcctcttcatcaagaggaagcttagatagttctcgttctgaaaaagatagaagtttg
gagagagaacgaggaattggtctaggcaactaccatccagcaacagaaaatccaggaacc
tcttcaaagcgaggtttgcagatctccaccactgcagcccagattgccaaagtcatggaa
gaagtgtcagccattcatacctctcaggaagacaggagttctgggtctaccactgaatta
cattgtgtgacagatgagagaaatgcacttaggagaagctctgctgcccatacacattca
aacacttacaatttcactaagtcagaaaattcaaataggacatgttctatgccttatgcc
aaattagaatacaagagatcttcaaatgatagtttaaatagtgtcagtagtagtgatggt
tatggtaaaagaggtcagatgaaaccgtcaattgaatcctattctgaagatgatgaaagt
aagttttgcagttatggtcaatacccagccgacctagcccataaaatacatagtgcaaat
catatggatgataatgatggagaactagatacaccaataaattatagtcttaaatattca
gatgagcagttgaactctggaaggcaaagtccttcacagaatgaaagatgggcaagaccc
aaacacataatagaagatgaaataaaacaaagtgagcaaagacaatcaaggagtcaaagt
acaacttatcctgtttatactgagagcactgatgataaacacctcaagttccaaccacat
tttggacagcaggaatgtgtttctccatacaggtcacggggagccaacagttcagaaaca
aatcgagtgggttctaatcatggaattaatcaaaatgtaagccagtctttgtgtcaagaa
gatgactatgaagatgataagcctaccaactatagtgaacgttactctgaagaagaacag
catgaagaagaagagagaccaacaaattatagcataaaatacaatgaagagaaacatcat
gtggatcagcctattgattatagtttaaaatatgccacagatattccttcgtcacagaaa
cagtcattttcattctcaaagagttcatctggacaaagcactaaaactgaacatatctct
tcaagcagtgagaatacgtccacaccttcatctaatgccaagaggcagaatcagctccat
ccaagttcggcacagagtagaagtggtcagactcaaaaggctgccacttgcaaagtttct
tctattaaccaagaaacaatacagacttattgtgtagaagatactccaatatgtttttca
agatgtagttcattatcatctttgtcatcagctgaagatgaaataggatgtgatcagacg
acacaggaagcagattctgctaataccctgcaaatagcagaaataaaagacaagattgga
actaggtcaactgaagaccctgtaagcgaagttccagcagtgtcgcagcacactagaacc
aaatccagcagactgcagggttctagtttatcttcagaatcaaccaggcacaaagctgtt
gaattttcttcaggagcaaaatctccctccaaaagcggtgctcagacacccaaaagtcca
cctgaacactatgttcaggagactccacttatgtttagcagatgtacttccgtcagttca
cttgatagttttgagagtcgttcgattgccagctccgttcagagtgaaccatgcagtgga
atagtaagtggcattataagccccagtgatcttccagatagccctggacaaaccatgcca
ccaagcagaagtaaaacccctccaccacctcctcaaacagcccaaaccaagcgagaagta
cctaaaaataaaacacctactgccgaaaagagagagagtggacctaagcaagctgcagta
aatgctgcagttcagagggtccaggttcttccagatgctgatactttattacactttgcc
acggaaagtactccagatggattttcttgttcatctagcctgagtgctctgagccttgat
gagccatttatacagaaagatgtggaattaagaataatgcctccagttcaggaaaatgac
aatgggaatgaaacagaatcagagcaacctaaagaatcaaatgaaaaccaagagaaagag
gcagaaaaaactattgattctgaaaaggacctattagatgattcagatgatgatgatatt
gaaatactggaagaatgtattatttctgccatgccaacaaagtcatcacgtaaagcaaaa
aagccagcccagactgcttcaaaattacctccacctgtggcaaggaaaccaagtcagctg
cctgtgtacaaacttctaccatcacaaaacaggttgcaaccccaaaagcatgttagtttt
acaccgggagatgatatgccacgagtatattgtgtagaagggacacctataaacttttcc
acagctacatctctaagtgatctaacaatagaatcccctccaaatgagttagctgctgga
gaaggagttagagcaggggcacagtcaggtgaatttgaaaaacgagataccattcctaca
gaaggcagaagtacagatgaggctcaaggaggaaaaacctcatctgtaaccatacctgaa
ttggatgacaataaagcagaggaaggtgatattcttgcagaatgcattaattctgctatg
cccaaagggaaaagtcacaagcctttccgtgtgaaaaagataatggaccaggtccagcaa
gcatctgcatcctcttctgcaaccaacaaaaatcagttagatggtaagaaaaagaaacca
acttcaccagtaaaacctataccacaaaatactgaatatcggacacgtataagaaaaaat
gcagactcaaaaaataatttaaatgctgagagagttttctcagacaacaaagattcaaag
aaacagaatttgaaaaataattccaaggacttcaatgataagctcccaaataatgaagat
agagtcagaggaagttttgcttttgattcacctcatcattacacacctattgaaggaact
ccttactgtttttcacgaaatgattctttgagttctctagattttgatgatgatgatgtt
gacctttccagggaaaaggctgaattaagaaaggcgaaagaaaataaggaatcagaagct
aaagttaccagccacacagaactaacctccaaccaacaatcagctagtaagacacaagct
attgcaaagcatccaataaatcgaggtcagcttaaacccatactgcagaagcaatccact
tttccccagtcatccaaagacataccagacagaggggcagcaactgatgaaaaattacat
aattttgctattgaaaatactccagtttgcttttctcataattcttctctgagttctctc
agtgacattgaccaagaaaacaacaacaataaagaaaatgaacctatcaaagagactgag
ccccctgattcacagggagaaccaagtaaacctcaagcatcaggctatgctccaaaatcg
tttcatgttgaagataccccagtttgtttctcaagaaacagttctctcagttctcttagt
attgactctgaagatgacctgttgcaggaatgtataagctccgcaatgccaaaaaagaaa
aagccttcaagacttaagggtgataatgaaaaacatagtcccagaaatatgggtggcatg
ttagctgaagatctgacacttgatttaaaagatatacagagaccagattcagaacatggt
ttatcccctgattcagaaaattttgattggaaagctattcaggaaggtgcaaattccata
gtaagtagtttacatcaagctgctgctgctgcatgtttatctagacaagcttcatctgat
tcagattccatcctttccctgaaatcaggaatctctctgggatcaccatttcatcttaca
cctgaccaagaagaaaaaccctttacaagtaataaaggcccacgaattctaaaaccaggg
gagaaaagtacattggaaactaaaaagatagaatctgaaagtaaaggaatcaaaggagga
aaaaaagtttataaaagtttgattactggaaaagttcgatctaattcagaaatttcaggc
caaatgaaacagccccttcaagcaaacatgccttcaatctctcgaggcaggacaatgatt
catattccaggagttcgaaatagctcctcaagtacaagtcctgtttctaaaaaaggccca
ccccttaagactccagcctccaaaagccctagtgaaggtcaaacggccaccacttctcct
agaggagccaagccatctgtgaaatcagaattaagccctgttgccaggcagacatctcaa
ataggtgggtcaagtaaagcaccttctagatcaggatctagagattcgaccccttcaaga
cctgcccagcaaccattaagtagacctatacagtctcctggccgaaactcaatttcccct
ggtagaaatggaataagtcctcctaacaaattatctcagcttccaaggacatcatctcct
agtactgcttcaactaagtcctcaggttctggaaaaatgtcgtatacatctccaggcaga
cagatgagccaacagaaccttaccaaacaaacaggtttatccaagaacgccagtagtatt
ccaagaagtgagtctgcctccaaaggactaaatcaggtgaataatggtaatggagccaat
aaaaaggtagagctttctagaatgtcttcaactaaatcaagtggaagtgaatctgataga
tcagaaagacctgtattagtacgccagtcaactttcatcaaagaagctccaagcccaacc
ttaagaagaaaattggaggaatctgcttcatttgaatccctttctccatcgtctagaccg
gcttctcccactaggtcccaggcacaaactccagttttaagtccttcccttcctgatatg
tctctatccacacattcatctgttcaggctggtggatggcgaaaactaccccctaatctc
agtcccactatagagtataatgatggaagaccagcaaagcgccatgatattgcacggtct
cattctgaaagtccttctagacttccaatcaataggtcaggaacctggaaacgtgagcac
agcaaacattcatcatcccttcctcgagtaagcacttggagaagaactggaagttcatct
tcaattctttctgcttcatcagaatccagtgaaaaagcaaaaagtgaggatgaaaaacat
gtgaactctatttcaggaaccaaacaaagtaaagaaaaccaagtatccgcaaaaggaaca
tggagaaaaataaaagaaaatgaaatttctcccacaaatagtacttctcagaccgtttcc
tcaggtgctacaaatggtgctgaatcaaagactctaatttatcaaatggcacctgctgtt
tctaaaacagaggatgtttgggtaagaattgaggactgtcccattaacaatcctagatct
ggaagatctcccacaggtaatactcccccggtgattgacagtgtttcagaaaagggaaat
ccaaacaaagattcaaaagataatcaggcaaaacaaaatgtgggtaatggcagtgttccc
atgcgtaccgtgggtttggaaaatcgcctgaactcctttattcaggtagatgcccctgac
cagaaaggaactgagacaaaaccaggacaaaataatcctgtccctgtatcagagactaat
gaaagttctatagtggaacgtaccccattcagttctagcagctcaagcaaacacagttca
cctagtgggactgttgctgccagagtgactccttttaattacaacccaagccctaggaaa
agcagcgcagatagcacttcagctcggccgtctcagatcccaactccagtgaataacaac
acaaagaagcgagattcaaaaactgacagcacagaatccagtggaacccaaagtcctaag
cgtcattctgggtcttaccttgtgacatccgtttaa

KEGG   Macaca mulatta (rhesus monkey): 707345
Entry
707345            CDS       T01028                                 

Gene name
APC2
Definition
(RefSeq) adenomatous polyposis coli protein 2 isoform X1
  KO
K02085  adenomatosis polyposis coli protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04310  Wnt signaling pathway
mcc04390  Hippo signaling pathway
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04810  Regulation of actin cytoskeleton
mcc04934  Cushing syndrome
mcc05010  Alzheimer disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05213  Endometrial cancer
mcc05217  Basal cell carcinoma
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    707345 (APC2)
   04390 Hippo signaling pathway
    707345 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    707345 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    707345 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    707345 (APC2)
   05206 MicroRNAs in cancer
    707345 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    707345 (APC2)
   05225 Hepatocellular carcinoma
    707345 (APC2)
   05226 Gastric cancer
    707345 (APC2)
   05217 Basal cell carcinoma
    707345 (APC2)
   05213 Endometrial cancer
    707345 (APC2)
   05224 Breast cancer
    707345 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    707345 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    707345 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    707345 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    707345 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    707345 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    707345 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    707345 (APC2)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     707345 (APC2)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    707345 (APC2)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     707345 (APC2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC APC_r Arm_APC_u3 Arm Suppressor_APC SAMP bZIP_1 HALZ
Other DBs
NCBI-GeneID: 707345
NCBI-ProteinID: XP_014977838
Ensembl: ENSMMUG00000003053
LinkDB
Position
19
AA seq 2384 aa
MGKEQRGKGGMRRGSGRRAEPREEAPASWTEGGGLGSQKTARGTKKLAALAEPRDGAGAA
GASREQLKAAQGVRATQTLQELKMASSVAPYEQLVRQVEALKAENSHLRQELRDNSSHLS
KLETETSGMKEVLKHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLKFQPPALG
PEPASQTPEGSPVHGSGPSKDSFGELSRATIRLLEELDRERCLLLNEIEKEEKEKLWYYS
QLQGLSKRLDELPHVETQFSMQMDLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRAS
RLEQIDKELLEAQDRVQQTEPQALLAVKSVPVDEDPETEVPTHPEDGTPQPGNSKVEVVF
WLLSMLATRDQEDTARTLLAMSSSPESCVAMRRSGCLPLLLQILHGTEAAAGGRAGAPGA
PGAKDARMRANAALHNIVFSQPDQGLARKEMRVLHVLEQIRAYCETCWDWLQARDGAPEG
GGASGVPVPIEPQICQATCAVMKLSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTRDP
LNLALRRYAGMTLTNLTFGDVANKATLCARRGCMEAIVAQLASDSEELHQVVSSILRNLS
WRADINSKKVLREAGSVTALVQCVLRATKESTLKSVLSALWNLSAHSTENKAAICQVDGA
LGFLVSTLTYKCQSNSLAIIESGGGILRNVSSLIATREDYRQVLRDHNCLQTLLQHLTSH
SLTIVSNACGTLWNLSARSARDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAH
RPAKHQAAATAVSPGSCVPSLYVRKQRALEAELDARHLAQALEHLEKHRPPAAEATSKKP
LPPLRHLDGLAQDYASDSGCFDDDDAPSSLAAAAATGEPASPAALSLFLGSPFLQGQALA
RTPPTRRGGKEAEKDASGEAAVAAKAKAKLALAVARIDQLVEDISALHTSSDDSFSLSSG
DPGQEAPREGRAQSCSPCRGPEGGRREAGSRAHPLLRLKAAHASLSNDSLNSGSASDGYC
PREHMLPCPLAALASRREDPRCGQPRPSRLDLDLPGSQAEPPAREATSADARVRTIKLSP
TYQHVPLLEGASRAGAEPLAGPGTSPGARKQAWLPADHLSKVPEKLAAAPLSVASKALQK
LVAQEGPLSLSRCSSLSSLSSAGRPGPSEGGDLDDTDSSLEGLEEAGPGEAELDSVWRAP
GATSLPVAIPAPRRNRGRGLGVEDATPSSSSENYVQETPLVLSRCSSVSSLGSFESPSIA
SSIPSDPCSGQGSGTISPSELPDSPGQTMPPSRSKTPPLAPAPQGPPEASQFSLQWESYV
KRFLDIADCRERCRLPSELDAGSVRFTVEKPDENFSCASSLSALALHEHYVQQDVELRLL
PSACPERGGGTGGAGLHFAGHRRREEGPAPTGSRPRGAADQELELLRECLGAAVPARLRK
VASALVPGRRALPVPVYMLVPAPARAQEDDSCTDSAEGTPVNFSSAASLSDETLQGPPRD
QPGGPEGRQRPTGRPTSARQAVGHRHKAGGAGRSVEQARGTGKNRAGLELPLGRPPSAPA
DKDDSKPGRTRGDGALQSLCLTTPTEEAVYCFYGNDSDEEPPAAAPTPTHRRTSAIPRAL
TRERLQGRKEAPAPSKAAPSAPPPTRAQPSLIADETPPCYSLSSSASSLSEPEPPEPPSV
SPRGQEPAVTKDPGPRGGRDSSPSPRAAEELLQRCISSALPRRRPPVSGLRRRKPRATRL
DERPAEGSREHGEEAAGSDRASDLDSVEWRAIQEGANSIVTWLHQAAAATREASSESDSI
LSFVSGLSVGSTLQPPKHRKGRQAGGEMGSARRPEKRGAASAKTSGSPRSPAGPEKPRGT
QKTTPGVPAVLRGRTVIYVPSPAPRAQPKGTPGPRATPRKVAPPCLAQSAAPAKVPSPGQ
QRSRSLHRPGKTSELGTLSQPPRSATPPARLAKTPSSSSSQTSPASQPLPRKRPLVTQAA
GPLPGPGASPVPKTPARTLLAKQHKTQRSPVRIPFMQKPARRGPPPLARAVPEPGPRGRA
GTEAGPGARGGRLGLVRVASALSSGSESSDRSGFRRQLTFIKESPGLRRRRSELSSAESA
ASAPQGTSPRRGRPALPAVFLCSSRCEELRAAPRQAPARQRPPAARPGPGERPARRTSSE
SPSRLPVRAPAARPETVKRYASLPHISVARRPDGTVPAAPAPADAARRSSDGEPRSLPRV
AAPGTTWRRIRDEDVPHILRSTLPATALPLRGSTPEDAPAGPPPRKTSDAVVQTEEVAAP
KTNSSTSPSLESREPPGAPASGQLSLLGSDVDGPSLAKAPISAPFVHEGLGVAVGGFPAS
RHGSPSRSARVPPFNYVPSPMVVAATTDSAAEKAPATSSATLLE
NT seq 7155 nt   +upstreamnt  +downstreamnt
atgggaaaggaacaaagagggaaggggggcatgaggaggggctccggcaggagggccgag
ccgagggaggaggcaccggccagctggacagagggaggaggtttggggagccagaagacg
gccagaggcacaaagaagctagcggcactggcagagccaagggatggggcaggggctgcc
ggggccagcagggagcagctgaaggctgcgcagggggtgcgggccacacagacgctgcag
gagctgaagatggcgagctccgtggcaccctacgagcagctggtgcggcaggtggaggcc
ttgaaggctgagaacagtcacctgaggcaggagctacgggacaactccagccacctgtcc
aagctggagacagagacgtcaggcatgaaggaggtcctgaagcacctacagggaaaactg
gagcaggaggcccgcgtgctggtgtcctcggggcagacggaggtgctggagcagttgaag
gccctgcagatggacatcaccagcctgtacaacctcaagttccagccgcccgccctgggc
ccggaacctgcctcccagacccccgagggcagcccggtacacggctccgggccttccaag
gacagctttggggagctgagccgggccaccatccggctgctggaggaactggaccgggaa
cggtgtttgctgctgaatgagattgagaaggaggagaaggagaagctttggtactactct
cagctgcagggcctgtccaagcgcctggacgagctgccgcacgtggagacgcagttctcg
atgcagatggacttgatccggcagcaacttgagttcgaggcccagcacatccgctcgctg
atggaggagcgcttcggcacctcggacgagatggtgcagcgggcacagatccgcgcctcg
cgcctggagcagattgacaaggagctgctggaggcgcaggaccgagtgcagcagacagag
ccccaggccttgctggcggtgaagtctgtgccggtggacgaggacccggagacagaggtc
cccacacaccctgaggatggcacccctcaaccgggcaacagcaaggtggaggtggtcttc
tggctgttgtccatgttggcgacgcgcgaccaggaggatacagcgcgcacgctactggcc
atgtcaagctcgcctgagagctgcgtggccatgcgccgctcgggctgtctgccactgctg
ctgcaaatcctccacggtactgaggccgcggccgggggtcgcgccggggccccaggagca
ccgggcgccaaagacgcacgcatgcgcgccaacgcggcgctgcacaacatcgtcttctcg
cagccggaccagggcctggcacgcaaggagatgcgcgtcctgcacgtgctggagcagatc
cgtgcctactgcgagacctgctgggactggctgcaggcccgagacggcgcgcccgaggga
ggcggcgccagcggcgtcccggtccccatcgagccgcagatctgccaggccacctgtgcg
gttatgaagctgtcctttgacgaggagtaccgccgtgccatgaacgagctgggtgggctg
caggccgtggcagagctgctgcaggttgactatgagatgcacaagatgacccgggacccg
ctgaacctggcactgcgccgctacgcgggcatgaccctcaccaacctcacctttggggat
gttgccaacaaggccaccctgtgtgcgcgccggggctgcatggaggccatcgtggcccag
ctggcctcggacagtgaggagctccaccaggtggtgtccagcatccttcggaacttgtcc
tggagggccgacatcaacagcaagaaggtgctgagggaggcgggcagcgtgacagccctg
gtgcagtgtgtcctgcgggccaccaaggagtccaccctgaagagtgtgctgagtgccctg
tggaatctgtctgcacacagcacggagaacaaggcggccatctgccaggtggacggcgcc
ctgggcttcctggtgagcaccctgacctacaagtgccagagcaactcgctggccatcatc
gagagcggcggcggcatcctccgcaacgtgtccagcctcatcgccacccgtgaggactac
aggcaggtgctccgggatcacaactgcctgcagacgctgttgcagcatctgacctcgcac
agcctgaccatcgtgagcaacgcatgcggcacactctggaacctatcagcccgcagcgcg
cgagaccaggagctgctgtgggacctgggcgctgtgggcatgctgcgcaatctggtgcac
tccaaacacaagatgatcgccatgggcagcgccgccgccctgcgcaacctgctcgcccat
cgacctgccaagcaccaggcggccgccaccgccgtgtccccaggcagctgcgtgcccagc
ctgtacgtgcgcaagcagcgggcgctggaggccgagctggacgcacggcacctggcgcag
gcgctggagcacctggagaagcaccgcccgccggcagccgaggccaccagcaagaagccg
ctgccgcccctgcgacacctggacggcctggcccaagactatgcttccgattctggctgc
tttgacgacgacgatgcaccgtcatccctggccgcggccgcggccaccggggagccagcc
agccctgccgcgttgtccctcttcctgggcagccccttcctgcaggggcaggcgctggcc
cgcaccccgcccacccgccgaggcggcaaggaggcagagaaggacgccagtggggaggcg
gccgtggcggccaaggccaaggccaagctggcgcttgcagtggcgcgcatcgaccagctg
gtggaggacatctccgccctgcatacctcgtcggacgatagcttcagcctcagctctgga
gacccggggcaggaggcgccacgggagggccgcgcccagtcctgctccccatgccgcggc
ccggagggtgggcggcgagaggcaggaagccgggcgcacccgctgctgcggctcaaggcg
gcccacgccagcctctccaacgacagcctcaacagtggcagtgccagcgacgggtactgc
ccacgcgaacacatgctgccttgcccgctggccgcactggcttcgcgccgcgaggacccc
aggtgtgggcagcctcggcccagccggcttgaccttgacctgccgggcagccaggccgag
ccgcctgcccgtgaagccacatccgccgacgcccgcgtgcgtaccatcaagctgtcacct
acctaccagcacgtgccactgctcgagggtgcctcaagggcgggtgcggagcccctcgcg
gggcctggaacctctccaggagcccggaagcaggcctggctgccggcagaccacctgagc
aaagttcctgagaagctagcagccgccccgctgtccgtggccagcaaggcactgcagaag
ctggtggcgcaggagggtccgctctcgttgtcccgatgtagctccctttcctcactgtcc
tctgccggccgcccaggccccagcgagggcggtgacctggatgacactgactcctctctg
gaggggctggaggaggcgggccccggcgaggctgagctggacagcgtgtggcgggcaccc
ggggccacctcgctgcccgtagccattccggctccccggcgcaaccgaggccggggcctg
ggggtggaggacgccacgccgtccagctcctcagagaactacgtgcaggagacaccgctg
gtgctgagccgctgcagctctgtgagctcgctgggtagctttgagagcccgtccattgcc
agctccatccccagtgacccttgcagcgggcagggcagcggcaccatcagccctagcgaa
ctgcccgacagccccgggcagaccatgcctcccagccggagcaagacgccgccactagcg
cctgcgccgcagggtccccccgaggccagccagttcagcctgcagtgggagagctacgtg
aagcgcttcctggacatcgccgactgccgagagcgctgccggctgccgtctgagctggac
gcaggcagcgtgcgcttcaccgtggagaagccggatgagaacttctcgtgcgcctcgagc
ctcagcgcgctggccttgcacgagcactacgtgcagcaggacgtggagctgcggctgctg
ccctcggcctgcccagagcgcggcgggggcacagggggcgccggcctccactttgcaggg
caccggcgacgggaggaggggccagcgcccacgggttctcgcccccgcggtgccgcggac
caggagttggagctgctgcgggagtgcctgggggccgccgtgcctgccaggctgcgcaag
gtggcctcggcgctggtgccaggtcgccgcgcgctccccgtgcccgtctacatgttggtg
cccgcccctgcccgggcccaggaggacgactcctgcactgactccgcggagggcacgcca
gtcaacttctccagcgccgcctccctcagcgacgagacactgcagggaccccccagggac
cagcccgggggaccagagggcaggcaaagacccaccggccgccccacctctgccaggcag
gccgtggggcaccggcacaaggcgggaggcgccggccgcagcgtggagcaggctcggggc
accggcaagaaccgagcagggctggagctgcccctgggccggcccccgagcgcccccgca
gacaaggacgactcgaagcccggccggacccgtggggacggggcacttcagtcgctgtgc
ctcacaacgcccaccgaggaggccgtgtactgcttctatggcaacgactcggacgaggag
cccccggcagctgcgcccacgcccacccaccggcgcacatcggccatcccccgcgctctt
acccgcgagcgcctgcagggccggaaggaggcccctgccccgtccaaggccgcaccatcc
gccccgccgcccacccgggcccagcccagcctcattgctgacgagaccccgccgtgctac
tccctgagctcctccgccagctccctcagcgagcccgagcccccggagccgccctccgtc
agtccacgaggccaggagcccgcggtcaccaaggacccgggcccgagaggcggacgcgac
agctcgcccagcccgcgggccgcggaggagcttctgcagcggtgcatcagctcggccctg
cccaggcgccggccccccgtgtccggcctgcggcgccgcaagccccgagccacccggctg
gatgagcggcctgcggaggggtcccgggaacacggcgaggaggcagcgggctcggaccgg
gcctctgacctggacagcgtggagtggcgcgccatccaggagggcgccaactccatcgtc
acgtggctgcaccaggcagcagctgccacgcgcgaggcctcctccgagtccgactccatc
ctgtcctttgtatccgggctgtcagtggggtctaccctacagccccccaaacacaggaag
ggacgacaggcagggggcgaaatgggcagtgcccggcggccagagaaacggggcgcagcc
tcagccaagaccagcgggagcccccgttcccctgcaggcccagagaagccacgtggcaca
cagaagaccacgcccggggtgccagctgtgctccggggacgaacagtgatctatgtgccc
agtccggcacctcgtgcccagcccaaagggacccccggcccccgcgccacaccgcggaag
gtggcgcccccttgcctggcacagtccgcagctccagccaaagtccccagccccggacag
cagcggtcgcggagcctacaccggcctggcaagacctcggaactggggacgctgagccag
ccccccaggagcgctacaccgcccgcccgcctcgccaagaccccctcctccagctcctcc
cagacctcgcccgcctcccagcccctgcccagaaagcgccccctggtcactcaggctgca
gggcccctgcccggccccggggcctccccagtgcccaagacgccggcgcgcactcttctg
gcgaagcagcacaagacgcagaggtcgcccgtgcgtatcccgttcatgcagaagccggcc
cggcgggggccgcccccgctggctcgggcagtcccggagccgggccccaggggccgggcg
gggaccgaggctggcccgggggcccgcggtggccgcctgggcctggtgcgcgtggcctcg
gccctctccagcggcagcgagtcctccgaccgctcaggcttccggcgacagctgaccttc
atcaaggagtcaccgggcttgcggcgccgccgctccgagctatcctcggccgagtctgcg
gcctctgccccccagggcacctcgccccgccgcggccggcccgcgctgcccgccgtcttc
ctctgctcctcgcgctgcgaagagctccgagcggcaccccggcaggccccggcccggcag
cggccccccgcggcccgacccggccccggcgagcgccctgcccggcgcaccagctccgag
agcccgtcccgcctgcccgtgcgcgcgcctgccgcccgacccgagacggtgaagcgctac
gcgtcgctgccgcacatcagcgttgcccgcagacccgacggcaccgtcccggctgcccca
gccccagccgacgccgcgcgccgcagcagcgacggagagccccggtcgctccccagggtg
gctgcgccgggcacgacgtggcggcgcatccgggacgaggacgtgccccacatcctgcgc
agcacgctgcccgccacggccctgccactgcggggctccacgcccgaggacgccccggcc
gggcccccgccgcgcaagaccagcgacgccgtggtccagactgaggaggtcgccgccccc
aagaccaactccagcacgtccccgagcctggagagcagggagccccccggggcccccgct
agcggccagctctccctccttggcagcgacgtggacgggcccagcctcgccaaggctccc
atctccgcacccttcgtgcatgagggcctgggggtcgccgtggggggcttccccgccagc
cggcacggctcccccagccgctcggcccgagtaccccccttcaactatgtgcccagcccc
atggtggtcgcagccaccaccgactcggccgcggagaaagccccggccacctcctccgcc
accctcctggaatag

DBGET integrated database retrieval system