KEGG   Macaca mulatta (rhesus monkey): 693445
Entry
693445            CDS       T01028                                 

Gene name
PIAS1
Definition
(RefSeq) E3 SUMO-protein ligase PIAS1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04120  Ubiquitin mediated proteolysis
mcc04630  JAK-STAT signaling pathway
mcc05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    693445 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    693445 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    693445 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    693445 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    693445 (PIAS1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     693445 (PIAS1)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   693445 (PIAS1)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    693445 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 693445
NCBI-ProteinID: NP_001253230
Ensembl: ENSMMUG00000011699
UniProt: F7HEF3 G7MY21
LinkDB
Position
7
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtactgttgggctacgctgggaggaacaagcacggacgcaaacacgaacttctcacaaaa
gccctgcatttgctaaaggctggctgtagtcctgctgtacaaatgaaaattaaggaactc
tataggcggcggttcccgcagaaaatcatgacgcctgcagacttgtccatccccaacgta
cattcaagtcctatgccagcaactttgtctccatctaccattccacagctcacttacgat
ggtcaccctgcatcatcgccattactccctgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacatcagctcttcacccagtccatccggatataaaacttcaaaaa
ttaccgttttatgatttactggatgaactgataaaacccaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgttttgcgtttgccttgacaccacaacaagtgcagcaa
atcagtagttccatggacatttctgggaccaaatgtgacttcacagtacaggtccagtta
aggttttgtttatcagaaaccagttgtccacaagaagatcacttcccacccaatctttgt
gtgaaagtgaatacaaaaccttgcagccttccaggttaccttccacctacaaaaaatggc
gtggaaccaaagcgacccagccgaccaattaatatcacctcacttgtccgactgtccaca
acagtaccaaacaccattgttgtttcttggactgcagaaattggaagaaactattccatg
gcagtatatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaatccggatcattctagagctttaattaaagagaagttgactgcagatccg
gacagtgaaatagctacaaccagcctaagggtttctctactgtgtccacttggtaaaatg
cggctgacaattccgtgtcgggcccttacatgttctcatctacagtgttttgacgcaact
ctttacattcagatgaatgagaaaaaaccaacctgggtttgtcctgtctgtgataagaag
gctccatatgaacaccttattattgatggcttgtttatggaaatcctaaagtactgtaca
gactgtgatgaaatacaatttaaggaggatggcacttgggcaccgatgagatcgaaaaag
gaagtacaagaagtttctgcctcttacaatggagtcgatggatgcttgagctccacattg
gagcatcaagtagcttctcaccaccagtcctcaaataaaaacaagaaagtagaagtgatt
gacctaaccatagacagttcatctgatgaagaggaagaagagccatctgccaagaggacc
tgtccttccctttctcccacatcaccactaaataataaaggcattttaagtcttccacat
caagcatctccagtatcccgcaccccaagccttcctgctgtagacacaagctacattaat
acctccctcatccaagactataggcatcctttccacatgacacccatgccttatgactta
caaggattagatttctttcctttcttatcaggagacaatcagcattacaacacctccttg
cttgccgctgcagcagcagcagtttcagatgatcaagacctcctacactcgtctcggttt
tttccgtatacctcttcacagatgtttcttgatcagttaagtgcaggaggcagtacttct
ctgccaaccaccaatggcagcagtagtggcagtaacagcagcctggtttcttccaacagc
ctaagggagagccatagccacaccgtcacaaacaggagcagcacggacacggcatccatc
tttggcatcataccagacattatttcactggactga

KEGG   Macaca mulatta (rhesus monkey): 696737
Entry
696737            CDS       T01028                                 

Gene name
PIAS2
Definition
(RefSeq) E3 SUMO-protein ligase PIAS2 isoform X4
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04120  Ubiquitin mediated proteolysis
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    696737 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    696737 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    696737 (PIAS2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     696737 (PIAS2)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   696737 (PIAS2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 696737
NCBI-ProteinID: XP_014977361
Ensembl: ENSMMUG00000004498
LinkDB
Position
18
AA seq 620 aa
MVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTL
EGLSDLSTIKSSVFSLDGSSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGSVLLQDTKPT
FEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVR
EICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPK
NGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLK
MKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFD
AALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRP
KKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAKRK
CIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDLP
GLDFLSLIPVDPQDITETSCFAKVSAVVSHIKYFIQIQCFWLICLHSSVNIRVVHSGLYL
FGSVMGSVTRIVRELVKYEH
NT seq 1863 nt   +upstreamnt  +downstreamnt
atggtttctagttttagggtttctgaactacaagtattactaggctttgctggacggaat
aaaagtggacgcaagcatgacctcctgatgagggcgctgcatttattgaagagcggctgc
agccctgcggttcagattaaaatccgagaattgtatagacgccgatatccacgaactctt
gaaggactttctgatttatccacaatcaaatcatcggttttcagtttggatggtagctca
tcacctgtagaacctgacttggccgtggctggaatccactctttgccttccacttcagtt
acacctcactcaccatcctctcctgttggttctgtgctgcttcaagatactaagcccaca
tttgagatgcagcagccatctcccccaattcctcctgtccatcctgatgtgcagttaaaa
aatctgcccttttatgatgtccttgatgttctcatcaagcccacaagtttagttcaaagc
agtattcagcgatttcaagagaagttttttatttttgctttgacacctcaacaagttaga
gagatatgcatatccagggattttttgccaggtggtaggagagattatacagtccaagtt
cagttgagactttgcctggcagagacaagttgccctcaagaagataactatccaaatagt
ctatgtataaaagtaaatgggaagctatttcctttgcctggctacgcaccaccgcctaaa
aatgggattgaacagaagcgccctggacgccccttgaatattacatctttagttaggtta
tcttcagctgtgccaaaccaaatatccatttcttgggcatcagaaattgggaagaattac
tccatgtctgtatatcttgtacggcagcttacatcagccatgttattacagagattaaaa
atgaaaggtattagaaaccctgatcattccagagcactaattaaagaaaaacttactgca
gatcctgatagtgaaattgctacaactagccttcgggtatccttgatgtgccctttagga
aaaatgagactgacaatcccatgccgtgcagtgacttgtacacatctgcagtgttttgat
gctgccctttatctacaaatgaatgagaagaagcccacctggatttgtcctgtgtgtgac
aaaaaagctgcctatgaaagtctaatattagatgggctttttatggaaattctcaatgac
tgttctgatgtggatgagatcaaattccaggaagatggttcttggtgtccaatgagaccg
aagaaagaagctatgaaagtatccagccaaccgtgtacaaaaatagaaagttcaagcgtc
ctcagtaagccttgttcagtgactgtagccagtgaggcaagcaagaagaaagtagatgtt
attgatcttacaatagaaagctcttctgatgaagaagaagaccctcctgccaaaaggaaa
tgcatctttatgtcagaaacacaaagcagcccaaccaaaggggttctcatgtatcagcca
tcttctgtaagggtgcccagtgtgacttcggttgatcctgctgctattccgccttcatta
acagactactcagtaccattccaccacacgccaatatcaagcatgtcatcagatttgcca
ggtttggattttctttcccttattccagttgatccccaggatatcactgagacctcctgt
tttgctaaagtcagtgcagtcgtttctcacataaaatattttatacagatacaatgcttt
tggctcatctgtcttcactcctctgttaatattagagtagtacactcaggtttgtacttg
tttggatcagtgatgggatcagtaaccaggattgtaagggaacttgtgaaatatgagcac
tag

KEGG   Macaca mulatta (rhesus monkey): 706775
Entry
706775            CDS       T01028                                 

Gene name
PIAS3
Definition
(RefSeq) LOW QUALITY PROTEIN: E3 SUMO-protein ligase PIAS3
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04120  Ubiquitin mediated proteolysis
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    706775 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    706775 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    706775 (PIAS3)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     706775 (PIAS3)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   706775 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 706775
NCBI-ProteinID: XP_015005696
Ensembl: ENSMMUG00000016733
UniProt: H9FNP4
LinkDB
Position
1
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPXDLSLLSLPPGTSPVGSPGPLAPXPPTLLAPGTLLGPKREVDMHPSLA
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLXPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGALGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHRSATPAXPPGRVSSIVAPG
GALREGHGGPLPSGPSLTGCRSDIISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagtttccgggtgtctgagctccag
gtgcttcttggctttgctggccggaacaagagtgggcggaagcacgagctcctggccaag
gccctgcacctcctgaagtccagctgtgcccctagcgtccagatgaagatcaaagagctt
taccgacgacgctttccccggaagaccctggggcctnctgatctctcccttctctctttg
cctcctggcacctctcctgtaggctcccctggtcctctagctccanttcccccaaccctc
ttggcccctggcaccctgctgggccccaagcgtgaggtggacatgcacccctctcttgcc
cagcctgtgcaccctgatgtcaccatgaaaccattgcccttctatgaagtctacggggag
ctcatccggcccaccacccttgcatccacttctagccagcggtttgaggaagcgcacttt
acctttgccctcacaccccagcaagtgcagcagattcttacatccagagaggttctgcca
ggagccaaatgtgattataccatacaggtgcagctaaggttctgtctctgtgagaccagc
tgcccccaggaagattattttccccccaacctctttgtcaaggtcaatgggaaactgtgc
cccctgccgggttaccttnccccaaccaagaatggggctgagcccaagaggcccagccgc
cccatcaacatcacacctctggctcgactctcagccactgttcccaacaccattgtggtc
aattggtcatctgagttcggacggaattactccttgtctgtgtacctggtgaggcagttg
actgcaggaacccttctacaaaaacttagagcaaagggaatccggaacccagaccactcg
cgggcactgatcaaggagaaattgactgctgaccctgacagtgaggtggccactacgagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgcctcactgtcccttgtcgtgcc
ctcacctgcgcccacctgcagagcttcgatgctgccctttatctccagatgaatgagaag
aagcctacgtggacatgtcctgtgtgtgacaagaaggctccctatgaatctcttatcatt
gatggtttatttatggagattcttagttcctgttcagattgtgatgagatccaattcatg
gaagatggatcctggtgcccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtacagcccagtccaggagggaaatccatcagag
aataagaagaaggtcgaagttattgacttgacaatagaaagctcatcagatgaggaggat
ctgccccctaccaagaagcactgttctgtcacctcagctgccatcccggccctacctgga
agcaaaggagtcctgacgtctggccaccagccatcctcggtgctaaggagccctgccatg
ggtgcgttgggtggggatttcctgtccagtctcccactacatgagtacccacctgccttc
ccactgggagccgatatccaaggtttagatttattttcatttcttcagacagagagtcag
cactatggcccctccgtcatcacctcactagatgagcaggatgcccttggccacttcttc
cagtaccgagggaccccttctcactttctgggcccactggcccccacgttggggagctcc
caccgcagtgccactccggcgncccctcctggccgtgtcagcagcattgtggcccctggg
ggagccttgagggaggggcatggaggacccctaccctcaggtccttctttgactggctgt
cggtcagacatcatttccctggactga

KEGG   Macaca mulatta (rhesus monkey): 714328
Entry
714328            CDS       T01028                                 

Gene name
PIAS4
Definition
(RefSeq) E3 SUMO-protein ligase PIAS4 isoform X2
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04064  NF-kappa B signaling pathway
mcc04120  Ubiquitin mediated proteolysis
mcc04630  JAK-STAT signaling pathway
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    714328 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    714328 (PIAS4)
   04064 NF-kappa B signaling pathway
    714328 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    714328 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    714328 (PIAS4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     714328 (PIAS4)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   714328 (PIAS4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP CDV3
Other DBs
NCBI-GeneID: 714328
NCBI-ProteinID: XP_014977974
Ensembl: ENSMMUG00000011018
UniProt: A0A1D5QIZ9
LinkDB
Position
19
AA seq 542 aa
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKNSEPAQQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELALTEQECVRTSQPAAVWTGPWRLPAAVTI
QAAVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQY
PPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITVTWGNYGKS
YSVALYLVRQLTSSELLQRLKTIGVKHPELCKALVKEKLRLDPDSEIATTGVRVSLICPL
VKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQLIIDGLLSKILS
ECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTG
GGGPVSGVENGKPGADVVDLTLDSSSSSEDEEEEEEEEEEDDEEGPRPKRRCPFQKGLVP
AC
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggcggcggagctggtggaggccaaaaacatggtgatgagttttcgagtctccgacctt
cagatgctcctgggtttcgtgggccggagtaagagcggactgaagcacgagctcgtcacc
agggccctccagctggtgcagtttgactgtagccccgagttgttcaaaaagatcaaggag
ctgtacgagacccgctacgccaagaagaactcggagcctgcccagcagccgcaccggccc
ctggaccccctgaccatgcactccacctacgaccgggccggcgctgtgcccaggactccg
ctggcaggccccaatattgactaccccgtgctctatgggaagtacttaaacggactggga
cggttacccgccaagacccttaagccagaagtccgcctggtgaagctgcccttctttaac
atgctggacgagctgctgaagcccaccgagttagcactgactgagcaggagtgtgtcagg
acctcgcagcccgcagcagtgtggacaggcccctggcgcctcccagcagccgtgaccatt
caggctgcagtcccacagaacaacgagaagcttcaggagagcccgtgcatcttcgcattg
acgccaagacaggtggagttgatccggaactccagagaactgcagcccggagttaaagcc
gtgcaggtcgtcctgagaatctgttactcagacaccagctgccctcaggaggaccagtac
ccgcccaacatcgctgtgaaggtcaaccacagctactgctcagtcccgggctactatccc
tccaataagcctggggtggaacccaagaggccgtgccgccccatcaacctcacccacctc
atgtacctgtcctcggccaccaaccgcatcaccgtcacctgggggaactacggcaagagc
tactccgtggccctgtacctggttcggcagttgacctcgtcagagctgctgcagaggctg
aagaccattggggtgaagcacccggagctgtgcaaggcactggtcaaggagaagctgcgc
ctggatcccgacagcgagatcgccaccactggtgtgcgggtgtccctcatctgcccgctg
gtgaagatgcggctctctgtgccctgccgggcagagacctgcgcccacctgcagtgcttc
gacgccgtcttctacctgcagatgaatgagaagaagcccacctggatgtgccccgtgtgc
gacaagccagccccctacgaccagctcatcatcgatgggctcctctcgaagatcctgagc
gagtgtgaggacgccgacgagatcgagtacctggtggacggttcgtggtgcccaatccgc
gccgaaaaggagcgcagctgcagcccgcagggcgccatcctcgtgctgggcccctcggat
gccaatgggctcctgcctgcccccagcgtcaacgggagcggtgccctgggcagcacgggc
ggcggcggcccggtgagcggcgtggagaatggaaagccgggcgccgacgtggtggacctc
acgctggacagctcatcgtcctcagaggatgaggaggaagaggaagaggaggaggaggag
gacgacgaagagggcccccggcccaagcgccgctgccccttccagaagggcctggtgccg
gcctgctga

DBGET integrated database retrieval system