KEGG   Macaca mulatta (rhesus monkey): 693520
Entry
693520            CDS       T01028                                 

Gene name
GLS
Definition
(RefSeq) glutaminase kidney isoform, mitochondrial isoform X1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00220  Arginine biosynthesis
mcc00250  Alanine, aspartate and glutamate metabolism
mcc00471  D-Glutamine and D-glutamate metabolism
mcc01100  Metabolic pathways
mcc04724  Glutamatergic synapse
mcc04727  GABAergic synapse
mcc04964  Proximal tubule bicarbonate reclamation
mcc05206  MicroRNAs in cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    693520 (GLS)
   00220 Arginine biosynthesis
    693520 (GLS)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    693520 (GLS)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    693520 (GLS)
  09156 Nervous system
   04724 Glutamatergic synapse
    693520 (GLS)
   04727 GABAergic synapse
    693520 (GLS)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    693520 (GLS)
   05230 Central carbon metabolism in cancer
    693520 (GLS)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     693520 (GLS)
SSDB
Motif
Pfam: Glutaminase EF-hand_14 Ank_2 Ank_4 Ank_3 Ank_5 Ank
Other DBs
NCBI-GeneID: 693520
NCBI-ProteinID: XP_014966069
UniProt: H9ESE7 I2CUE6
LinkDB
Position
12
AA seq 669 aa
MMRLRGSAMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRSGGRPAAGPAAAARLHPWWGG
GGWPAGPLVRGLSSSPSEILQELGKGSTHPQSGVSPPAAPAAPGPKDSPGETDAFGNSEG
KELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKK
QSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDL
GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVE
VVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
VHKNLDGLL
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgatgcggctgcgaggctcggcgatgctgcgggacctgctcctgcggtcgccagccggc
gtgagcgcgactctgcggcgggcacagcccctggtcaccctgtgccggcgtccccgaagc
gggggacggccggccgcgggcccagctgccgccgcgcgactccacccgtggtggggcggg
ggcggctggccggcggggccccttgtgcggggcctgtccagctctccctcggagatcttg
caggagctgggcaaggggagcacgcatccgcagtccggggtgtcgccacccgctgccccg
gcggcgcccggccccaaggacagccccggggagacggacgcgtttggcaacagcgagggc
aaagagctggtggcctcaggtgaaaataaaataaaacagggtctgttacctagcttggaa
gatttgctgttctatacaattgcggaaggacaagagaaaatacccgttcataaatttatt
acagcactcaaatctacaggattgcgaacgtctgatcccaggttgaaagagtgtatggat
atgttaagattaactcttcaaacaacatcagatggtgtcatgctagacaaagatcttttt
aaaaaatgtgttcagagcaacattgttttgttgacacaagcctttagaagaaagtttgtc
attcctgactttatgtcttttacctcacacattgatgagttatatgaaagtgctaaaaag
cagtctggaggaaaggttgcagattatattcctcaactggccaaattcagtcctgatttg
tggggtgtgtctgtttgtacagtagatggacagaggcattctattggagataccaaagtt
cccttctgtcttcagtcctgtgtaaaacctttgaaatatgccattgctgttaatgatctt
ggaactgaatatgtgcatcgatatgttggaaaagagccgagtggactaagattcaacaaa
ctatttttgaatgaagatgataaaccacataatcctatggtaaatgctggagcaattgtt
gtgacttcactaataaagcaaggagtaaataatgctgaaaaatttgactatgtcatgcag
tttttgaataagatggctggtaatgaatatgttggattcagtaatgcgacgtttcagtct
gaaagagaaagtggagatcgaaattttgcaataggatattacttaaaagaaaagaagtgt
tttccagaaggcacagatatggttggtatattagacttctacttccagctgtgctccatt
gaagtgacttgtgaatcagccagtgtgatggctgcgacactggctaatggtggtttctgc
ccaattactggtgaaagagtactgagccctgaagcagttcgaaatactttgagtttgatg
cattcctgtggcatgtatgacttctcagggcagtttgcttttcatgttggtcttcctgca
aaatctggagttgctgggggcattcttttagttgtccccaatgttatgggtatgatgtgc
tggtctcctcctctggataagatgggcaacagtgttaagggaattcacttttgtcacgat
cttgtttctctgtgtaatttccataactatgataatttgagacactttgcaaaaaaactt
gatcctcgaagagaaggtggtgatcaaagggtaaagtcagtgataaatcttttgtttgct
gcatatactggagatgtgtctgcacttcgaagatttgctttgtcagctatggacatggaa
cagcgggactatgattctagaacagcactgcatgtagctgctgcagagggtcatgttgaa
gttgttaaatttttgctggaagcctgcaaagtaaaccctttccccaaggacaggtggaat
aacactcccatggatgaagcactgcactttggacaccatgatgtatttaaaattctccaa
gaataccaagtccagtacacacctcaaggagattctgacaacgggaaggaaaatcaaacc
gtccataagaatcttgatggattgttgtaa

KEGG   Macaca mulatta (rhesus monkey): 712962
Entry
712962            CDS       T01028                                 

Gene name
GLS2
Definition
(RefSeq) glutaminase liver isoform, mitochondrial isoform X1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00220  Arginine biosynthesis
mcc00250  Alanine, aspartate and glutamate metabolism
mcc00471  D-Glutamine and D-glutamate metabolism
mcc01100  Metabolic pathways
mcc04724  Glutamatergic synapse
mcc04727  GABAergic synapse
mcc04964  Proximal tubule bicarbonate reclamation
mcc05206  MicroRNAs in cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    712962 (GLS2)
   00220 Arginine biosynthesis
    712962 (GLS2)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    712962 (GLS2)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    712962 (GLS2)
  09156 Nervous system
   04724 Glutamatergic synapse
    712962 (GLS2)
   04727 GABAergic synapse
    712962 (GLS2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    712962 (GLS2)
   05230 Central carbon metabolism in cancer
    712962 (GLS2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     712962 (GLS2)
SSDB
Motif
Pfam: Glutaminase EF-hand_14 Ank_2 Ank_4 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 712962
NCBI-ProteinID: XP_001115245
Ensembl: ENSMMUG00000000860
UniProt: F7H7H2
LinkDB
Position
11
AA seq 602 aa
MRSMKALQKSLSRASSHCRRGDWSHLSRSPLLGEGVRHHLSEAAAQGRETPHSRQPQHQD
HDSSESGMLSRLGDLLFYTIAEGQEQIPIHKFTTALKATGLQTSDPRLQDCMSEMHRVVQ
ESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDAKELTGGKVA
AYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSYRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRREGG
EVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSDTQAEAAAEALSKENLES
MV
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgcgctccatgaaggctctgcagaagtcgctgagccgggccagcagtcactgccggcgg
ggagactggagtcacctgagccggagccccctccttggcgagggcgtccggcaccacctc
agtgaggccgcggcgcagggcagagagacaccacacagccgccagccgcagcaccaggat
catgattcatcagaaagtggcatgctgtcccgcctgggtgatttgctcttctacactatt
gctgaaggacaggaacaaatccctatccacaagttcaccactgcactaaaggccactgga
ctgcagacatcagatcctcggctccaagactgcatgagcgagatgcaccgtgtggtccaa
gagtccagtagtggtggcctcttggaccgagatctcttccgaaagtgtgtgagcagcaac
attgtgctcctgacccaggcattccgaaagaagtttgtcattcctgattttgaggagttc
acgggccatgtggatcgcatctttgaggatgccaaagagctcactggaggcaaagtggca
gcctacatccctcagctggccaagtcaaacccagacctgtggggtgtctccctgtgcact
gtggatggtcagcggcactctgtgggccacacaaagatccccttctgcctgcagtcctgt
gtgaagcccctcacctatgccatctccataagcaccctaggcactgactacgtgcacaag
tttgtgggcaaagagcctagtggcctgcgctacaacaagctctccctcaatgaggaagga
atcccccataaccccatggtcaatgctggtgccattgttgtcagctccctgatcaagatg
gactgtaacaaagcagagaagtttgattttgtgttgcagtatctcaacaaaatggctggg
aatgaatacatgggtttcagcaatgccacattccagtcggagaaggaaacaggggatcgg
aattatgccattggctattatctcaaggaaaagaagtgctttcctaagggggtggacatg
atggctgcccttgatctctacttccagctgtgctctgtggaggtcacttgtgaatcaggc
agtgtcatggcagccaccctcgccaatggtgggatctgccccatcacaggcgagagtgtg
ctgagtgctgaagcagtgcgcaacaccctcagcctcatgcattcctgcggcatgtatgac
ttctctggccagtttgccttccacgtgggcctgccagccaagtcagctgtatcaggagcc
atcctcctggtggtacccaatgtcatgggaatgatgtgcctgtcacccccactggacaag
ctggggaacagctatagggggaccagcttctgccagaagttggtgtctctcttcaatttc
cacaactatgacaacctgaggcactgtgctcggaagttagacccacggcgtgaaggggga
gaagttcggaacaagactgtggtcaacctgttatttgcggcctacagtggtgatgtctca
gctcttcgaaggtttgccttgtcggccatggatatggaacagaaagactatgactcgcgc
acagctctgcatgttgctgcagctgaaggacacatcgaagttgttaaattcctgatcgag
gcttgcaaagtgaatccttttgccaaggacagatggggcaacattcccctggatgatgct
gtgcagttcaaccatctggaggtggtcaaactgcttcaagattaccaggattcctacaca
ctctctgacactcaggctgaggcagcagctgaggccctgtctaaagagaacttagaaagc
atggtatga

DBGET integrated database retrieval system