KEGG   Macaca mulatta (rhesus monkey): 693523
Entry
693523            CDS       T01028                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04727  GABAergic synapse
mcc04740  Olfactory transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04962  Vasopressin-regulated water reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05032  Morphine addiction
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    693523 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    693523 (ADCY3)
   04371 Apelin signaling pathway
    693523 (ADCY3)
   04020 Calcium signaling pathway
    693523 (ADCY3)
   04072 Phospholipase D signaling pathway
    693523 (ADCY3)
   04024 cAMP signaling pathway
    693523 (ADCY3)
   04022 cGMP-PKG signaling pathway
    693523 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    693523 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    693523 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    693523 (ADCY3)
   04062 Chemokine signaling pathway
    693523 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    693523 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    693523 (ADCY3)
   04912 GnRH signaling pathway
    693523 (ADCY3)
   04913 Ovarian steroidogenesis
    693523 (ADCY3)
   04915 Estrogen signaling pathway
    693523 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    693523 (ADCY3)
   04921 Oxytocin signaling pathway
    693523 (ADCY3)
   04926 Relaxin signaling pathway
    693523 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    693523 (ADCY3)
   04918 Thyroid hormone synthesis
    693523 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    693523 (ADCY3)
   04916 Melanogenesis
    693523 (ADCY3)
   04925 Aldosterone synthesis and secretion
    693523 (ADCY3)
   04927 Cortisol synthesis and secretion
    693523 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    693523 (ADCY3)
   04270 Vascular smooth muscle contraction
    693523 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    693523 (ADCY3)
   04971 Gastric acid secretion
    693523 (ADCY3)
   04972 Pancreatic secretion
    693523 (ADCY3)
   04976 Bile secretion
    693523 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    693523 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    693523 (ADCY3)
   04727 GABAergic synapse
    693523 (ADCY3)
   04725 Cholinergic synapse
    693523 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    693523 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    693523 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    693523 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    693523 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    693523 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    693523 (ADCY3)
   04714 Thermogenesis
    693523 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    693523 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    693523 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    693523 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    693523 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    693523 (ADCY3)
   05163 Human cytomegalovirus infection
    693523 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    693523 (ADCY3)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     693523 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA RAP1 OPA3 Peptidase_S49_N
Other DBs
NCBI-GeneID: 693523
NCBI-ProteinID: NP_001192150
Ensembl: ENSMMUG00000009600
LinkDB
Position
13
AA seq 1144 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGIGLLLDII
LFVLCKKELLPDRATRRVVPYLLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHS
SGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFVVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPSNATAGMETKGGCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVAAINLYAWRPVFDEYDHRRFREHDLPMVTLEKMQGFTPGLNGTDRLPLVPSKY
SMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPATFPNGPSVTLPHQV
VDNS
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctctgagcccgagtactcggccgagtactcagccgagtac
tccgtcagcctgccctccgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactcgggctcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctctaccagacttacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgctgccctctttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcgacaagctggctcccctcgccgtggctggaattggactgctgttggacatcatc
ctcttcgtgctctgcaaaaaggagctgctcccggaccgggccacccgcagagtggtgccc
tatctgctgtggctgctcataactgcccagatcttctcctacctgggcctgaacttcgcg
cgtgcccacgcggccagtgacaccgtgggctggcaggtcttcttcgtcttctccttcttc
atcacgctgcctctcagcctcagccccatcgtgatcatctccgtggtctcctgtgtggtg
cacaccttggtcctgggggtcactgtggcccagcagcagcaggaggagctgaaggggatg
cagctgctgcgcgagatcctggccaacgtcttcctctacctgtgtgccatcgctgtgggc
atcatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggctgatgagatgctgaaagacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgccgacatcgtgggctttacccagctgtcttctgcctgcagtgcccaggagctc
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcagctaaataccaccag
ctgcggattaagatcctgggcgactgctactactgcatctgcggcctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgggagaagaccaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgatgtgtggtcaactgacgtcact
gtagccaacaagatggaggccggcggcatccctgggcgtgtgcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtggaaccaggcgatgggggcagccgctgtgac
tacctagaagagaagggtattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagccacccagaatggcctcaatggctcggccctgcccaatggagcaccagcttcc
tcaaagtccagctcccctgccctcattgagaccaaggagcccaacgggagtgcccacagc
agcgggtccacatcagagaaacccgaggagcaggatgcccaggctgacaacccctcattc
cccaacccgcgccggaggctgcgcctgcaggacctggctgaccgagtggtggacgcctcc
gaagacgagcacgagctcaaccagctgctcaacgaggccctgctggagcgagagtctgcc
caagtagtaaagaagagaaacaccttcctcctgtccatgcggttcatggaccctgagatg
gaaacacgctactcggtggagaaggagaagcagagtggggctgccttcagctgctcctgc
gtcgtcctgctctgcacggctctggtcgagatactcatcgacccctggctaatgacaaac
tatgtgaccttcgtggtgggtgagattctgctcctcatcctgaccatctgctccctggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcgacttggattgaccgg
acccgctgggccaggaacacctgggccatgctcgccatcttcatcctggtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacacaggacccagcaacgcgacagcaggg
atggagacgaagggcggctgcctggagaaccccaagtattacaactacgtggccgtgctg
tctctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgcttatg
ctgctcgtcgcgggcgccgtggccgccatcaacctctacgcctggcgccccgtcttcgat
gaatacgaccaccggcgttttcgggagcatgacttacctatggtgaccttagagaagatg
cagggattcacccctgggctcaacggcactgacaggctgcccctggtgccttccaagtac
tccatgacggtgatggtgttcctcatgatgctgagcttctactacttctcccgccatgta
gaaaaactggcacggacacttttcttgtggaagattgaggtccacgaccagaaggaacgt
gtctacgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcacgtg
gcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagacgtatgat
gagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggagagc
atcaacaatggcggtatcgagtgtctgcgtttcctcaatgaaatcatctcggattttgac
tctctcctggacaatcccaagttccgggtgatcaccaagatcaaaaccattggcagcacg
tacatggcagcttcaggagtcacccctgacgtcaacactaatggctttgccagctccaac
aaggaggacaagtctgagagagaacgctggcagcacctggctgacctggccgactttgca
ctggccatgaaggatacgctcaccaacatcaacaatcagtccttcaataacttcatgctg
cgcataggcatgaacaaaggcggggttctggctggggtcatcggagcccggaaaccacac
tacgacatctggggcaatacggtcaatgtagccagcaggatggagtccacgggggtcatg
ggcaacatccaggtggtagaagaaacccaagtcatcctccgagagtacggcttccgcttt
gtgaggcgaggccccatctttgtgaagggaaagggggagttgctgaccttcttcttgaag
gggcgggacaagccagccaccttccccaacggcccctctgtcacactgccccaccaggtg
gtagacaactcctga

DBGET integrated database retrieval system