KEGG   Macaca mulatta (rhesus monkey): 693523
Entry
693523            CDS       T01028                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04727  GABAergic synapse
mcc04740  Olfactory transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04962  Vasopressin-regulated water reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05032  Morphine addiction
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    693523 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    693523 (ADCY3)
   04371 Apelin signaling pathway
    693523 (ADCY3)
   04020 Calcium signaling pathway
    693523 (ADCY3)
   04072 Phospholipase D signaling pathway
    693523 (ADCY3)
   04024 cAMP signaling pathway
    693523 (ADCY3)
   04022 cGMP-PKG signaling pathway
    693523 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    693523 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    693523 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    693523 (ADCY3)
   04062 Chemokine signaling pathway
    693523 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    693523 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    693523 (ADCY3)
   04912 GnRH signaling pathway
    693523 (ADCY3)
   04913 Ovarian steroidogenesis
    693523 (ADCY3)
   04915 Estrogen signaling pathway
    693523 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    693523 (ADCY3)
   04921 Oxytocin signaling pathway
    693523 (ADCY3)
   04926 Relaxin signaling pathway
    693523 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    693523 (ADCY3)
   04918 Thyroid hormone synthesis
    693523 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    693523 (ADCY3)
   04916 Melanogenesis
    693523 (ADCY3)
   04925 Aldosterone synthesis and secretion
    693523 (ADCY3)
   04927 Cortisol synthesis and secretion
    693523 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    693523 (ADCY3)
   04270 Vascular smooth muscle contraction
    693523 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    693523 (ADCY3)
   04971 Gastric acid secretion
    693523 (ADCY3)
   04972 Pancreatic secretion
    693523 (ADCY3)
   04976 Bile secretion
    693523 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    693523 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    693523 (ADCY3)
   04727 GABAergic synapse
    693523 (ADCY3)
   04725 Cholinergic synapse
    693523 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    693523 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    693523 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    693523 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    693523 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    693523 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    693523 (ADCY3)
   04714 Thermogenesis
    693523 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    693523 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    693523 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    693523 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    693523 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    693523 (ADCY3)
   05163 Human cytomegalovirus infection
    693523 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    693523 (ADCY3)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     693523 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA RAP1 OPA3 Peptidase_S49_N
Other DBs
NCBI-GeneID: 693523
NCBI-ProteinID: NP_001192150
Ensembl: ENSMMUG00000009600
LinkDB
Position
13
AA seq 1144 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGIGLLLDII
LFVLCKKELLPDRATRRVVPYLLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHS
SGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFVVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPSNATAGMETKGGCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVAAINLYAWRPVFDEYDHRRFREHDLPMVTLEKMQGFTPGLNGTDRLPLVPSKY
SMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPATFPNGPSVTLPHQV
VDNS
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctctgagcccgagtactcggccgagtactcagccgagtac
tccgtcagcctgccctccgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactcgggctcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctctaccagacttacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgctgccctctttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcgacaagctggctcccctcgccgtggctggaattggactgctgttggacatcatc
ctcttcgtgctctgcaaaaaggagctgctcccggaccgggccacccgcagagtggtgccc
tatctgctgtggctgctcataactgcccagatcttctcctacctgggcctgaacttcgcg
cgtgcccacgcggccagtgacaccgtgggctggcaggtcttcttcgtcttctccttcttc
atcacgctgcctctcagcctcagccccatcgtgatcatctccgtggtctcctgtgtggtg
cacaccttggtcctgggggtcactgtggcccagcagcagcaggaggagctgaaggggatg
cagctgctgcgcgagatcctggccaacgtcttcctctacctgtgtgccatcgctgtgggc
atcatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggctgatgagatgctgaaagacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgccgacatcgtgggctttacccagctgtcttctgcctgcagtgcccaggagctc
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcagctaaataccaccag
ctgcggattaagatcctgggcgactgctactactgcatctgcggcctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgggagaagaccaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgatgtgtggtcaactgacgtcact
gtagccaacaagatggaggccggcggcatccctgggcgtgtgcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtggaaccaggcgatgggggcagccgctgtgac
tacctagaagagaagggtattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagccacccagaatggcctcaatggctcggccctgcccaatggagcaccagcttcc
tcaaagtccagctcccctgccctcattgagaccaaggagcccaacgggagtgcccacagc
agcgggtccacatcagagaaacccgaggagcaggatgcccaggctgacaacccctcattc
cccaacccgcgccggaggctgcgcctgcaggacctggctgaccgagtggtggacgcctcc
gaagacgagcacgagctcaaccagctgctcaacgaggccctgctggagcgagagtctgcc
caagtagtaaagaagagaaacaccttcctcctgtccatgcggttcatggaccctgagatg
gaaacacgctactcggtggagaaggagaagcagagtggggctgccttcagctgctcctgc
gtcgtcctgctctgcacggctctggtcgagatactcatcgacccctggctaatgacaaac
tatgtgaccttcgtggtgggtgagattctgctcctcatcctgaccatctgctccctggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcgacttggattgaccgg
acccgctgggccaggaacacctgggccatgctcgccatcttcatcctggtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacacaggacccagcaacgcgacagcaggg
atggagacgaagggcggctgcctggagaaccccaagtattacaactacgtggccgtgctg
tctctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgcttatg
ctgctcgtcgcgggcgccgtggccgccatcaacctctacgcctggcgccccgtcttcgat
gaatacgaccaccggcgttttcgggagcatgacttacctatggtgaccttagagaagatg
cagggattcacccctgggctcaacggcactgacaggctgcccctggtgccttccaagtac
tccatgacggtgatggtgttcctcatgatgctgagcttctactacttctcccgccatgta
gaaaaactggcacggacacttttcttgtggaagattgaggtccacgaccagaaggaacgt
gtctacgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcacgtg
gcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagacgtatgat
gagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggagagc
atcaacaatggcggtatcgagtgtctgcgtttcctcaatgaaatcatctcggattttgac
tctctcctggacaatcccaagttccgggtgatcaccaagatcaaaaccattggcagcacg
tacatggcagcttcaggagtcacccctgacgtcaacactaatggctttgccagctccaac
aaggaggacaagtctgagagagaacgctggcagcacctggctgacctggccgactttgca
ctggccatgaaggatacgctcaccaacatcaacaatcagtccttcaataacttcatgctg
cgcataggcatgaacaaaggcggggttctggctggggtcatcggagcccggaaaccacac
tacgacatctggggcaatacggtcaatgtagccagcaggatggagtccacgggggtcatg
ggcaacatccaggtggtagaagaaacccaagtcatcctccgagagtacggcttccgcttt
gtgaggcgaggccccatctttgtgaagggaaagggggagttgctgaccttcttcttgaag
gggcgggacaagccagccaccttccccaacggcccctctgtcacactgccccaccaggtg
gtagacaactcctga

KEGG   Macaca mulatta (rhesus monkey): 694730
Entry
694730            CDS       T01028                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase type 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04727  GABAergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05032  Morphine addiction
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    694730 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    694730 (ADCY7)
   04371 Apelin signaling pathway
    694730 (ADCY7)
   04020 Calcium signaling pathway
    694730 (ADCY7)
   04072 Phospholipase D signaling pathway
    694730 (ADCY7)
   04024 cAMP signaling pathway
    694730 (ADCY7)
   04022 cGMP-PKG signaling pathway
    694730 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    694730 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    694730 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    694730 (ADCY7)
   04062 Chemokine signaling pathway
    694730 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    694730 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    694730 (ADCY7)
   04912 GnRH signaling pathway
    694730 (ADCY7)
   04913 Ovarian steroidogenesis
    694730 (ADCY7)
   04915 Estrogen signaling pathway
    694730 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    694730 (ADCY7)
   04921 Oxytocin signaling pathway
    694730 (ADCY7)
   04926 Relaxin signaling pathway
    694730 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    694730 (ADCY7)
   04918 Thyroid hormone synthesis
    694730 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    694730 (ADCY7)
   04916 Melanogenesis
    694730 (ADCY7)
   04925 Aldosterone synthesis and secretion
    694730 (ADCY7)
   04927 Cortisol synthesis and secretion
    694730 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    694730 (ADCY7)
   04270 Vascular smooth muscle contraction
    694730 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    694730 (ADCY7)
   04971 Gastric acid secretion
    694730 (ADCY7)
   04972 Pancreatic secretion
    694730 (ADCY7)
   04976 Bile secretion
    694730 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    694730 (ADCY7)
   04727 GABAergic synapse
    694730 (ADCY7)
   04725 Cholinergic synapse
    694730 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    694730 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    694730 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    694730 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    694730 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    694730 (ADCY7)
   04714 Thermogenesis
    694730 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    694730 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    694730 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    694730 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    694730 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    694730 (ADCY7)
   05163 Human cytomegalovirus infection
    694730 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    694730 (ADCY7)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     694730 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 694730
NCBI-ProteinID: XP_014981583
Ensembl: ENSMMUG00000003118
UniProt: A0A1D5QQN7
LinkDB
Position
20
AA seq 1093 aa
MPSRPWGLLNGRGWKMPAKGRYFLNEGEEGPDQDALYEKYRLTSQHGPLLLTLLLVAATA
CVALIVIAFSQGDPSRHQAILGMAFLALAVFAALTVLMYVECLLRRWLRALALLTWACLV
ALGYVLVFNAWTKAACAWEQVPFFLFIVFVVYTLLPFSMRGAIAVGAVSTASHLLVLGAL
MGGFTTPSVRVGLQLLANTVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIE
KRQQENLLLSVLPAHISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSILYADI
VGFTRLASDCSPKELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHAR
NCVKMGLDMCQAIKQVREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRM
EAAGVPGRVHITEATLKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQ
HLHRPKGDAALKMRASVRMTRYLESWGAARPFAHLNHRESVSSGETPVPNGRRPKSVPQR
HRRTPDRSMSPKGRSEDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREY
RLAPIPRARHDFACAGLIFVCILLVHVLLMPRTAALGVSFGLVACVLGLVLGLCFATKFS
RWCPARGTLCTISERVETQPLLRLTLAILTIGSLLTVAIVNLPLMPFPELPVGNETGLPA
ASSKTRALCEPLPYYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQW
DCCGQGLGNLTEPNGTTSGTPSCSWRDLKTMTNFYLVLFYITLLTLSRQIDYYCRLDCLW
KKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPD
FKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVAS
GHENQELERQHAHIGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKP
QYDIWGNTVNVASRMESTGELGKIQVTEETCTILQSLGYSCECRGLINVKGKGELRTYFV
CTDTAKFQGLGLN
NT seq 3282 nt   +upstreamnt  +downstreamnt
atgccctccaggccctggggcctccttaacggccgagggtggaagatgccggccaagggg
cgctacttcctcaacgagggcgaggagggtcctgaccaagatgcgctctacgagaagtac
cggctcaccagccagcatgggccgctgctgctcacgctcctgctggtggccgccactgcc
tgcgtggccctcatcgtcatcgccttcagccagggggacccctccagacaccaggccatt
ctgggcatggcgttcctggcgctggcagtgtttgcagccctcactgtgctgatgtatgtc
gagtgtctcctgcggcgctggctcagggccttggcgctgctcacgtgggcctgcctggta
gccctgggctacgtgctggtgttcaacgcgtggacgaaggcggcctgtgcgtgggagcag
gtgcccttcttcctgttcatcgtctttgtggtgtacacgctgctgcccttcagcatgcgg
ggcgctatcgctgtgggggccgtctccaccgcctcccacctcctggtgctcggcgctttg
atgggaggcttcacgacacccagtgtccgggtggggctgcagctgctggccaacacagtc
atcttcctgtgcgggaacctgacaggcgccttccacaagcaccaaatgcaggatgcgtcc
cgggacctcttcacctacactgtgaagtgcatccagatccgccggaagctgcgcatcgag
aagcgccagcaggagaacctgctgctatcggtgcttccagcccacatctccatgggcatg
aagctggccatcatcgaacggctcaaggagcatggcgaccgccgctgcatgcccgacaac
aacttccacagcctctacgtcaagaggcaccagaatgtcagcatcctctatgcggacatc
gtgggcttcacgcggctggccagcgactgctcccccaaggagttggtggtggtgctgaac
gagctctttggcaagttcgaccagatcgccaaggccaacgagtgcatgcggatcaagatc
cttggtgactgctactactgtgtatcgggcctgcccgtgtcgctgcccactcacgcccgg
aactgtgtgaagatggggctggacatgtgccaggccatcaagcaggtgcgggaggccacg
ggcgtggacatcaacatgcgtgtgggcatacactcggggaacgtgctgtgcggggtcatc
gggctgcgcaagtggcagtatgacgtatggtcccacgatgtgtccctggccaaccggatg
gaggcagccggagtccccggccgggtgcacatcacggaggcgacactgaagcacctggac
aaggcgtacgaggtggaggatgggcacgggcagcagcgggacccctacctcaaggagatg
aacatccgcacctacctggtcatcgacccccggagccagcagccacccccgcccagccaa
cacctccacagacccaagggggatgcggccctgaagatgcgggcgtcagtgcgcatgacc
cggtacctcgagtcctggggggcagcgcggccctttgcgcatctcaaccaccgcgagagc
gtgagcagtggcgagacccccgtccccaacgggcggaggcctaagagcgttccccagcgc
caccgccggaccccagacaggagcatgtcccccaaggggcggtcggaggatgattcatac
gatgacgagatgctgtcagccatcgaggggctcagctccacgaggccctgctgctccaag
tctgacgacttctacaccttcgggtccatcttcctggagaagggctttgagcgcgagtat
cgcctggcacccatcccccgggcccgccacgactttgcctgcgccggcctgatttttgtc
tgcatcctgctcgtccacgtcctgctcatgcccaggacggcggcgctgggtgtgtccttt
gggctggtggcctgtgtactggggctggtactgggcctgtgctttgccaccaagttctcg
aggtggtgcccagctcgggggacactctgcactatctccgagagggtggagacgcagccc
ctgctgaggctgaccctggccatcctgaccatcggcagcctgctcactgtggctatcgtc
aacctgcccctgatgcctttcccagagctgcctgttggcaacgagacaggcctaccagct
gcgagcagcaagaccagagccctgtgcgagcccctcccgtactatacctgcagctgtgtc
ctgggcttcatcgcctgctccgtcttcctgaggatgagcctggaaccaaaggttgtgctg
ctgacagtggccctggtggcctacctggtgctcttcaacctctccccatgctggcagtgg
gactgctgcggccaaggcctgggcaacctcaccgagcccaatggtaccaccagcggcacc
cctagctgttcctggagggacctgaagaccatgaccaatttctacctggtcctgttctac
atcaccctgctcacgctctccagacagattgactattactgccgcctggactgtctatgg
aagaagaagttcaagaaggagcacgaggagtttgagaccatggagaacgtgaaccgcctt
cttctggagaacgtcctgccagcccacgtggctgcccactttatcggtgacaagttaaac
gaggactggtaccatcagtcctatgactgcgtctgtgtcatgtttgcctccgtgccggac
ttcaaagtgttctacacagagtgcgatgtcaacaaagaagggctggagtgcctgcgcctg
ctcaatgagatcattgccgacttcgacgagctcctgctgaagcccaagttcagcggcgtg
gagaagatcaagaccatcggcagcacatacatggcagctgcagggctcagtgtcgcctca
gggcacgagaaccaggagctggagcggcagcacgcccacattggcgtcatggtggagttc
agcatcgccctgatgagcaagctggacggcatcaacaggcactccttcaactccttccgc
ctccgcgtcggcataaaccatgggcctgtgattgctggagtgattggggcccgaaaacct
cagtatgacatctggggaaacacagtcaacgtggccagccgaatggagagcaccggagaa
cttgggaaaatccaggttaccgaggagacctgcaccatcctccagagcctcgggtactct
tgcgaatgccgtggcctgatcaatgtcaaaggcaaaggcgagctgagaacttactttgtc
tgtacggacactgccaagtttcaggggctggggctgaactga

KEGG   Macaca mulatta (rhesus monkey): 695328
Entry
695328            CDS       T01028                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase type 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04727  GABAergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05032  Morphine addiction
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    695328 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    695328 (ADCY2)
   04371 Apelin signaling pathway
    695328 (ADCY2)
   04020 Calcium signaling pathway
    695328 (ADCY2)
   04072 Phospholipase D signaling pathway
    695328 (ADCY2)
   04024 cAMP signaling pathway
    695328 (ADCY2)
   04022 cGMP-PKG signaling pathway
    695328 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    695328 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    695328 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    695328 (ADCY2)
   04062 Chemokine signaling pathway
    695328 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    695328 (ADCY2)
   04922 Glucagon signaling pathway
    695328 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    695328 (ADCY2)
   04912 GnRH signaling pathway
    695328 (ADCY2)
   04913 Ovarian steroidogenesis
    695328 (ADCY2)
   04915 Estrogen signaling pathway
    695328 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    695328 (ADCY2)
   04921 Oxytocin signaling pathway
    695328 (ADCY2)
   04926 Relaxin signaling pathway
    695328 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    695328 (ADCY2)
   04918 Thyroid hormone synthesis
    695328 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    695328 (ADCY2)
   04916 Melanogenesis
    695328 (ADCY2)
   04925 Aldosterone synthesis and secretion
    695328 (ADCY2)
   04927 Cortisol synthesis and secretion
    695328 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    695328 (ADCY2)
   04270 Vascular smooth muscle contraction
    695328 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    695328 (ADCY2)
   04971 Gastric acid secretion
    695328 (ADCY2)
   04972 Pancreatic secretion
    695328 (ADCY2)
   04976 Bile secretion
    695328 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    695328 (ADCY2)
   04727 GABAergic synapse
    695328 (ADCY2)
   04725 Cholinergic synapse
    695328 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    695328 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    695328 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    695328 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    695328 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    695328 (ADCY2)
   04714 Thermogenesis
    695328 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    695328 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    695328 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    695328 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    695328 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    695328 (ADCY2)
   05163 Human cytomegalovirus infection
    695328 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    695328 (ADCY2)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     695328 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 695328
NCBI-ProteinID: NP_001252581
Ensembl: ENSMMUG00000018742
UniProt: A0A1D5RHE7
LinkDB
Position
6
AA seq 1091 aa
MWQQAMRRRRYLRDRAEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGACLA
LLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAM
GYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSAT
PGGKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQ
ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFT
RLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVK
MGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPR
HTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTL
RTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAF
KYYVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLLLAFILFVCFAGQLLQCSKKASP
LLMWLLKSSGIIANRPWPRISLTIITTAIILTMAVFNMFFLSDSEETIPPTANTTNTSFS
ASNNQAAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHT
HAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKK
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEDLYHQSYDCVCVMFASIPDFKEFY
TESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHA
QEPERQYMHIGTMVEFAFALVAKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDI
WGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEM
SRSLSQSNVAS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atgtggcagcaggcgatgcggcgccgccgctacctgcgggaccgcgccgaggaggcggcg
ggcggcggagacgggctgccgcggtcccgggactggctctacgagtcctactactgcatg
agccagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggcgcctgcctcgcc
ctgctcgccgtcttcttcgcgctcgggctggaagttgaagaccatgtggcgtttctaata
acagttccgaccgccctggcgattttctttgcgatatttatcctggtctgcatagagtct
gtgtttaagaaactgctgcgcctcttctcgttggtgatatggatatgccttgttgccatg
ggatacctgttcatgtgttttggaggtaccgtctctccctgggaccaggtatcgttcttc
ctcttcatcatcttcgtggtgtacaccatgctgcccttcaacatgcgagacgccatcatt
gccagtgtcctcacctcctcctcccacaccatcgtgcttagcgtctgcctgtctgcaacg
ccgggaggcaaggagcacctggtctggcagatcctggccaatgtgatcattttcatctgt
gggaacctggcgggagcctaccataagcacctcatggaacttgctcttcagcaaacatat
caggacacctgtaattgcatcaagtcccggatcaagttggaatttgaaaaacgtcaacag
gagcggcttctgctctccctgctgccggcccacatcgccatggagatgaaagcggagatc
atccagaggttgcagggccccaaggcaggccagatggagaacacaaataacttccacaac
ctgtacgtgaagcggcataccaacgtgagcatcttatacgctgacattgttggctttacc
cggctggcaagtgactgctccccaggagaactagttcacatgctgaatgagctcttcgga
aagtttgatcaaattgcaaaggagaatgaatgcatgagaattaaaattttaggagactgc
tactactgtgtatctggactccctatatctctccctaaccatgccaagaactgtgtgaaa
atgggactggacatgtgtgaagccataaagaaagtgagggatgctactggagttgatatc
aatatgcgtgtgggcgtgcattctgggaacgtcctgtgcggcgtgattggtctgcagaag
tggcagtatgatgtgtggtcacatgacgtgaccttggccaaccacatggaagctggaggg
gtccctggacgtgttcacatttcttccgtcaccctggagcacttgaatggcgcttataaa
gtggaggagggagatggtgacattagggacccatatttaaagcagcacctggtgaaaacc
tactttgtaatcaaccccaagggagaacgacggagcccccagcatctcttcagacctcgc
cacaccctcgacggagccaaaatgagggcctcggtccgcatgacccggtacttggagtcc
tggggggcggccaagccctttgcacacctacatcacagggacagcatgaccacagagaac
ggcaagatcagcaccacggatgtacccatgggtcagcataattttcaaaatcgcacctta
agaaccaagtcacaaaagaaaagatttgaagaagaattgaatgaaaggatgattcaagca
attgatgggattaatgcacaaaagcaatggctcaagtctgaagacattcagagaatctca
ctgcttttctataacaaagtactagaaaaagagtaccgggccacggcactgccagcattc
aagtattacgtgacttgtgcctgtctcatattcttctgtatcttcattgtgcagattctc
gtgctgccaaaaacgtccgtcctgggcatctcctttggggctgcgtttctcttgctggcc
ttcatcctcttcgtctgctttgctggacagcttctgcaatgcagcaaaaaagcctctccc
ctgctcatgtggcttttgaagtcctcaggcatcattgccaaccgaccctggccacggatc
tctctcacgatcatcactacagccatcattttaaccatggccgtgttcaacatgtttttc
ctgagtgactcagaggaaacaatccctccaactgccaatacaacaaacacaagcttttca
gcctcaaataatcaggcggcgattctgcgtgcgcaaaatttatttttcctcccgtacttt
atctacagctgcattctgggactgatatcctgttccgtgttcctgcgggtgaactacgag
ctgaagatgttgatcatgatggtggcgttggtgggctacaacaccatcctacttcacacc
cacgcccacgtcctgggcgactacagccaggtcttgtttgagagaccaggcatttggaaa
gacctgaagactatgggctctgtgtctctctctatattcttcatcacactgcttgttctg
ggtagacagaatgaatattactgtaggttagacttcttatggaagaacaagttcaaaaaa
gagcgggaggagatagagaccatggagaacctgaaccgtgtgctgctggagaacgtgctt
cccgcacacgtcgctgagcacttcctggccaggagcctgaagaatgaggatctataccac
cagtcctatgactgtgtctgcgtcatgtttgcctccattccggatttcaaagaattttat
acagaatccgacgtgaacaaggagggcttggaatgccttcggctcctgaacgagatcatc
gctgactttgatgatcttctttccaagccaaaattcagtggagttgaaaagattaagacc
attggcagcacatacatggcagcaacaggtctgagcgctgtgcccagccaggagcacgcc
caggagcccgagcggcagtacatgcacattggcaccatggtggagtttgcctttgccctg
gtagcgaagctggatgccatcaacaagcactccttcaacgacttcaaattgcgagtaggt
attaaccatggacctgtgatagctggtgtgattggagctcagaagccacaatatgatatc
tggggcaacactgtcaatgtggccagtaggatggacagcaccggagtcctggacaaaata
caggttacggaggagacaagcctcgtcctgcagaccctcggatacacatgcacctgtcga
ggaataatcaacgtgaaaggaaagggggacctgaagacgtactttgtaaacacagaaatg
tcaaggtccctttcccagagcaatgtggcatcctga

KEGG   Macaca mulatta (rhesus monkey): 695792
Entry
695792            CDS       T01028                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase type 8 isoform X1
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04727  GABAergic synapse
mcc04742  Taste transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05032  Morphine addiction
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    695792 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    695792 (ADCY8)
   04371 Apelin signaling pathway
    695792 (ADCY8)
   04020 Calcium signaling pathway
    695792 (ADCY8)
   04072 Phospholipase D signaling pathway
    695792 (ADCY8)
   04024 cAMP signaling pathway
    695792 (ADCY8)
   04022 cGMP-PKG signaling pathway
    695792 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    695792 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    695792 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    695792 (ADCY8)
   04062 Chemokine signaling pathway
    695792 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    695792 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    695792 (ADCY8)
   04912 GnRH signaling pathway
    695792 (ADCY8)
   04913 Ovarian steroidogenesis
    695792 (ADCY8)
   04915 Estrogen signaling pathway
    695792 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    695792 (ADCY8)
   04921 Oxytocin signaling pathway
    695792 (ADCY8)
   04926 Relaxin signaling pathway
    695792 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    695792 (ADCY8)
   04918 Thyroid hormone synthesis
    695792 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    695792 (ADCY8)
   04916 Melanogenesis
    695792 (ADCY8)
   04925 Aldosterone synthesis and secretion
    695792 (ADCY8)
   04927 Cortisol synthesis and secretion
    695792 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    695792 (ADCY8)
   04270 Vascular smooth muscle contraction
    695792 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    695792 (ADCY8)
   04971 Gastric acid secretion
    695792 (ADCY8)
   04972 Pancreatic secretion
    695792 (ADCY8)
   04976 Bile secretion
    695792 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    695792 (ADCY8)
   04727 GABAergic synapse
    695792 (ADCY8)
   04725 Cholinergic synapse
    695792 (ADCY8)
   04720 Long-term potentiation
    695792 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    695792 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    695792 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    695792 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    695792 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    695792 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    695792 (ADCY8)
   04714 Thermogenesis
    695792 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    695792 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    695792 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    695792 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    695792 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    695792 (ADCY8)
   05163 Human cytomegalovirus infection
    695792 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    695792 (ADCY8)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     695792 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 695792
NCBI-ProteinID: XP_001084919
Ensembl: ENSMMUG00000010440
UniProt: A0A1D5Q874
LinkDB
Position
8
AA seq 1251 aa
MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSSS
GSGGSGKASDPAGGGPNHHAPQLSGDSALPLYSLGPGERAHSTCGTKVFPERSGSGSASG
SGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRK
SEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHT
YLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
LLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEAR
LRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAH
CCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKL
ESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPED
IVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHV
QSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAF
IVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINE
TYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLRYDNLNHSGEDFLGTKEA
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVA
RHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDE
LLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKH
SFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLIL
KDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
QSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgccttacaggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcaggagcgcctcccggccgcagcggctgttgtggcagacg
gcggtgcggcacatcactgagcagcgcttcattcacgggcaccggggaggcagcagcagc
ggaagtggaggctcgggcaaagcatcggaccctgcgggcggcggccccaaccaccacgcg
ccgcagctgtcaggcgactcggcgctgcccctctactcgctgggcccgggagagcgagcg
cacagcacctgcggcaccaaagtcttcccggaacgcagcgggagcggcagtgccagcggc
agcggaggcgggggcgacctgggcttcctgcaccttgactgtgcccctagcaactcggat
ttctttctcaatgggggttatagctaccgaggggtcattttccccaccctgcgcaactcc
ttcaaatctcgggatctggaacgcctctaccagcgctatttcttgggccagaggcgcaaa
tcggaagtggtgatgaacgtgctggacgtgctgaccaaactcactctcttggtcctgcac
ttgagcctggcctcggcccccatggacccgctcaagggcatcctgctgggcttcttcacc
ggcattgaggtggtgatctgcgccctggtggtggttaggaaggacaccacctcccacacg
tacctgcagtacagcggcgtggtcacctgggtggccatgaccacccagatcctagcagca
ggcctcggctacgggctcctgggcgacggcataggctacgtgctcttcacgctcttcgcc
acctacagcatgctgccgctgccgctcacctgggccatcctggccggcctgggcacctcg
ctgctgcaggtcatcctccaagtggtcatcccccggctggcggtcatttccatcaaccag
gttgtggcccaggcagtgttattcatgtgtatgaacacagctggaatcttcatcagttac
ctgtcagaccgggcccagcgccaagctttcctggagactcggaggtgtgtggaggccagg
ctgcgcctggagacagagaaccaaagacaggagcggctcgtgctttctgtgctcccccgg
tttgttgtcctggaaatgatcaacgacatgaccaatgtggaagacgagcacctgcagcac
cagttccatcggatctacatccatcgctatgagaatgtcagtattctttttgcagatgtt
aaaggatttaccaacctctccacgaccttgtctgctcaggagctggtcaggatgctcaac
gagctctttgccagatttgatcgactggcccatgagcatcactgccttcgtattaaaatt
ctgggggactgctactactgcgtgtctggacttcctgagccccgccaggatcatgcccac
tgctgtgttgaaatgggtctcagcatgatcaaaaccatcaggtatgtgcggtcaaggaca
aaacatgatgttgacatgaggattggaatccactcaggctcggtgctgtgtggtgttctg
ggactaaggaagtggcagtttgatgtctggtcttgggatgtggacattgcaaacaaactc
gaatctggaggaatccctgggaggattcacatttccaaagccacgctggactgcctcaac
ggtgactataacgtggaagagggtcacggtaaagagaggaatgaattcctgaggaagcat
aatatcgagacttatttaattaagcagcctgaggacagcctgctgtccttgcctgaagat
atcgtcaaggagtcagtgagctcctcagaccggagaaacagtggggccacgttcactgaa
ggatcctggagccctgagctaccctttgataatatcgtggggaaacagaatactctggct
gccctaacaagaaattcaataaatctgcttccaaaccatcttgcacaagctttgcatgtc
cagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagtggc
gataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagcctg
gagcacaagtattctcaaatgagggatgaagtgttcaagtcaaacttggtctgtgcattt
atcgttcttctgtttatcacggcaatacaaagtttgcttccttcttcaagagtgatgcca
atgaccatccagttctccattctgattatgctgcattcggctctggtcctcatcaccaca
gcagaggattataagtgtttgcccctcatcctccggaaaacttgctgttggattaatgag
acctatttggcccggaacgtcatcatctttgcatccatcttgattaatttcctgggcgcc
atcttaaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttc
aattcctcagctgtgtttacagatatctgctcctacccagagtactttgtcttcacgggg
gtgttggccatggtgacctgtgcagttttcctccgtctaaactccgtcctgaagctggca
gtgctgctgatcatgatcgccatctatgccctgctcactgagaccatctacgcaggcctc
tttctgcgttacgataacctcaaccacagtggagaagatttcctggggaccaaggaggcg
tcgctgctgctgatggccatgttcctcctggctgtgttctaccatggacagcagctggag
tacacagcccgcctggacttcctttggcgagtgcaggccaaagaggagatcaatgagatg
aaggagctgagggaacacaatgagaacatgctccggaatatcttacccagccacgtggcc
cgccatttcctagagaaggaccgagacaatgaggagctgtattctcaatcctatgatgct
gttggggtgatgtttgcctccatcccaggatttgcggacttttactctcagactgaaatg
aataaccagggagtggaatgcctgcgcttgctgaatgagatcattgctgacttcgatgag
ttgcttggtgaagaccgatttcaagacattgaaaagattaagaccattggcagcacctac
atggccgtgtcaggcctatctcctgaaaaacagcaatgtgaagacaagtggggacatttg
tgcgctctggctgacttctcactcgccctgacagaaagcatacaggagatcaacaagcat
tcattcaacaattttgaactccggattggcatcagccatggctcagtggtagctggcgtt
atcggcgctaagaaaccacagtatgacatttggggcaaaactgtgaacctggcaagccga
atggacagcacaggggttagtggccggatccaagtcccagaggagacctatctcatcctg
aaggaccagggctttgcctttgattaccgaggggagatctatgtgaagggcatcagtgaa
caggaaggaaaaatcaaaacgtactttctcctgggaagagtccaacccaacccattcatc
ttgcccccaagaagactgcctgggcagtactccctggctgcggttgtcctgggacttgtc
cagtccctcaataggcaaaggcagaagcagctactcaatgagaacaacaacacgggaatc
atcaagggtcattataaccggcggactttgttgtcacccagcggcacggagcctggagcc
caagctgaaggcaccgacaaatctgatttgccataa

KEGG   Macaca mulatta (rhesus monkey): 697230
Entry
697230            CDS       T01028                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase type 1 isoform X1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04727  GABAergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05032  Morphine addiction
mcc05142  Chagas disease
mcc05146  Amoebiasis
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    697230 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    697230 (ADCY1)
   04371 Apelin signaling pathway
    697230 (ADCY1)
   04020 Calcium signaling pathway
    697230 (ADCY1)
   04072 Phospholipase D signaling pathway
    697230 (ADCY1)
   04024 cAMP signaling pathway
    697230 (ADCY1)
   04022 cGMP-PKG signaling pathway
    697230 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    697230 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    697230 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    697230 (ADCY1)
   04062 Chemokine signaling pathway
    697230 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    697230 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    697230 (ADCY1)
   04912 GnRH signaling pathway
    697230 (ADCY1)
   04913 Ovarian steroidogenesis
    697230 (ADCY1)
   04915 Estrogen signaling pathway
    697230 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    697230 (ADCY1)
   04921 Oxytocin signaling pathway
    697230 (ADCY1)
   04926 Relaxin signaling pathway
    697230 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    697230 (ADCY1)
   04918 Thyroid hormone synthesis
    697230 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    697230 (ADCY1)
   04916 Melanogenesis
    697230 (ADCY1)
   04925 Aldosterone synthesis and secretion
    697230 (ADCY1)
   04927 Cortisol synthesis and secretion
    697230 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    697230 (ADCY1)
   04270 Vascular smooth muscle contraction
    697230 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    697230 (ADCY1)
   04971 Gastric acid secretion
    697230 (ADCY1)
   04972 Pancreatic secretion
    697230 (ADCY1)
   04976 Bile secretion
    697230 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    697230 (ADCY1)
   04727 GABAergic synapse
    697230 (ADCY1)
   04725 Cholinergic synapse
    697230 (ADCY1)
   04720 Long-term potentiation
    697230 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    697230 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    697230 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    697230 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    697230 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    697230 (ADCY1)
   04714 Thermogenesis
    697230 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    697230 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    697230 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    697230 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    697230 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    697230 (ADCY1)
   05163 Human cytomegalovirus infection
    697230 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    697230 (ADCY1)
   05142 Chagas disease
    697230 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    697230 (ADCY1)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     697230 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053
Other DBs
NCBI-GeneID: 697230
NCBI-ProteinID: XP_014989077
Ensembl: ENSMMUG00000006421
LinkDB
Position
3
AA seq 1118 aa
MAGAPRGGGGGGGGAGEPGGAERAAGPSRRRGLRACDEEFACPELEALFRGYTLRLEQAA
TLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQLQ
QVGQLALLFSLTFALLCCPFALGGPARGSAGAAGGPAAAEQGVWQLLLVTFVSYALLPVR
SLLAIGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFVGVNMYGVFVRILTERSQR
KAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPDRIFHKIYIQRHD
NVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGL
TQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWS
NDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLKTHNIETFFIVPSH
RRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALR
TASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQK
YHQLQDEYFTSAVVLTLILAALFGLVYLLIFPQSVAVLLLLVFCICFLVACVLYLHITRV
QCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWSSKPNSSLVVLSSGGQRTALP
TLPCESTHHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYILVLELSGYTRTGGGAV
SGRSYEPIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNL
LPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEI
IADFDELMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFD
VLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQV
TEEVHRLLRRCPYHFVCRGKVSVKGKGEMLTYFLGRTDGNGSQIRSLGLDRKMGPYGRAG
LQGRRPPVCPMPGVSVRAGLPPHSPGQYLSSAAAGKEA
NT seq 3357 nt   +upstreamnt  +downstreamnt
atggcgggggcgccgcgcggcggaggcggcggcggaggcggcgcgggcgagcccgggggc
gccgagcgggcggccgggccaagccgccggcgcgggctccgggcgtgcgacgaggagttc
gcttgcccagagctggaggcgctgttccgcggctacacgctgcggctggagcaggcggcc
acgctgaaggcgctggccgttctcagcctgctggcgggcgcgctggcgctggctgagctg
ctgggcgcgccggggcccgcgcccggcctggccaagggctcgcacccggtgcactgcgtc
cttttcctggcgctgctcgtggtaaccaacgtccggtccctgcaggtgccccagctgcag
caggtcggccagctggcgctgctcttcagcctcaccttcgcgctgctctgctgtcctttc
gcgctgggcggccccgcccggggttccgccggggccgctggggggccagcggctgccgaa
caaggggtttggcagctccttttggtcaccttcgtgtcctatgccttgctgcccgtgcgc
agcctgctggccatcggctttgggctcgtggtggctgcgtcgcacttgctggtcacagcc
accttggtccccgccaagcgcccacgtctctggaggacgctcggcgccaacgccttgctc
tttgtcggtgtgaacatgtatggggtcttcgtgcggattctgactgagcgttcgcagagg
aaggcgttcctgcaggcccggagctgcattgaggaccgactgaggctggaggatgagaac
gagaagcaggagcggctcctcatgagcctcctgccccggaacgttgccatggagatgaag
gaggacttcctgaagccccctgacaggattttccacaagatttacatccagaggcacgac
aatgtgagcatcctgtttgctgacatcgtgggtttcacgggcttggcatcccagtgcacg
gcccaggagctggtgaaactcctcaatgagctcttcggcaagtttgacgagttagccacg
gagaaccactgtcgtcgcatcaagattctcggggactgctactactgcgtgtcaggactc
acccagcccaagactgaccatgcccactgctgcgtggagatggggctcgacatgattgat
accatcacatctgtggctgaagccaccgaggtggacctgaacatgcgtgtgggtctgcac
acgggcagggtcctctgtggtgtcctgggcttgcgcaagtggcagtatgacgtgtggtcc
aatgatgtgaccttggccaatgtcatggaagccgctggcctgccagggaaggttcatatc
acaaagacgaccctagcgtgcttgaatggggactacgaggtagaaccaggttacggacat
gagaggaacagtttcttgaaaactcataacattgaaaccttttttattgtgccatcccat
cgccgaaagatatttccaggcctgattctctcagatataaaaccggccaagaggatgaag
ttcaagactgtctgctacctgctggtgcagctcatgcactgccgaaagatgttcaaggcc
gagatccccttctccaatgtcatgacctgcgaggacgatgacaagcggagggcgttgaga
acagcctcagaaaaactcagaaaccgctcatctttttctaccaacgttgtctacaccacc
ccgggcactcgtgtcaacaggtacatcagccgcctcttagaagcccgccagacagagctg
gagatggcagacctgaacttctttaccctgaagtacaaacatgtcgaacgggagcaaaag
taccaccagcttcaggacgagtatttcaccagcgctgttgtcctcaccctcatcctggct
gccttatttggccttgtctaccttctaatattcccacagagtgtggccgtcctgctcctg
ctagtattctgcatctgcttcctggtggcctgtgtcctgtacctgcacatcacccgggtc
cagtgttttccagggtgcctgacgattcagattcgcactgtcctgtgtattttcatagtg
gtcttaatctactcagtagcccaaggatgtgtggtgggctgcctgccctgggcctggagc
tccaagcccaacagttccctggtggtcctttcatccgggggccagcgcacagccctgccc
accctgccctgcgagtctacgcaccatgccctgctctgctgcctggtgggcaccctcccg
ctagccatattttttcgggtgtcctccttgccaaaaatgatcctgctgtccgggctcacc
acgtcctacatcctcgtactggagctcagcggatacaccaggactgggggtggtgccgtc
tccgggcgcagctatgagccgattgtggccatcctgctcttctcctgtgcgctggccctg
catgccaggcaggtggacatcaggctgaggctggactacctctgggccgcacaggcagag
gaggagcgagaggacatggagaaggtgaagctggacaacaggcgcatcctcttcaacctc
ctgccagcccacgtcgcccagcacttcctcatgtccaaccctcggaacatggacctctac
taccagtcctactcccaggtgggcgtcatgtttgcctccatccccaactttaatgacttc
tacatcgagctggacggcaacaacatgggggtggagtgtctgcggcttctcaacgagatc
attgccgactttgacgagctcatggaaaaagacttttacaaggacatagagaagatcaag
accattgggagcacctacatggccgctgtggggctagcgcctacttcggggaccaaggct
aagaagtccatctcctcccacctgagcacgctggcagactttgccattgagatgtttgac
gttctggatgaaatcaactaccagtcttacaatgactttgtcctccgagttggcatcaat
gttggccccgtggtggctggagtgattggcgctcgcaggccccagtacgacatctgggga
aacacagtcaacgtggccagtcggatggacagcacaggggtccagggtagaatccaggtg
actgaggaggtccaccggctgctgagaagatgcccctaccactttgtgtgccgaggcaaa
gtcagtgtcaagggcaaaggcgagatgttgacatactttctaggcaggactgatggaaac
ggctcccaaatcaggtccctgggcttggatcggaaaatgggtccatatgggagagctggc
cttcagggcagacgtcccccggtgtgccccatgcctggcgtctcagtcagggctgggctc
cctccacactccccaggccagtatctgtcctctgcagcagctgggaaggaggcttag

KEGG   Macaca mulatta (rhesus monkey): 706789
Entry
706789            CDS       T01028                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase type 9 isoform X1
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04727  GABAergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04962  Vasopressin-regulated water reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05032  Morphine addiction
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    706789 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    706789 (ADCY9)
   04371 Apelin signaling pathway
    706789 (ADCY9)
   04020 Calcium signaling pathway
    706789 (ADCY9)
   04072 Phospholipase D signaling pathway
    706789 (ADCY9)
   04024 cAMP signaling pathway
    706789 (ADCY9)
   04022 cGMP-PKG signaling pathway
    706789 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    706789 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    706789 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    706789 (ADCY9)
   04062 Chemokine signaling pathway
    706789 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    706789 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    706789 (ADCY9)
   04912 GnRH signaling pathway
    706789 (ADCY9)
   04913 Ovarian steroidogenesis
    706789 (ADCY9)
   04915 Estrogen signaling pathway
    706789 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    706789 (ADCY9)
   04921 Oxytocin signaling pathway
    706789 (ADCY9)
   04926 Relaxin signaling pathway
    706789 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    706789 (ADCY9)
   04918 Thyroid hormone synthesis
    706789 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    706789 (ADCY9)
   04916 Melanogenesis
    706789 (ADCY9)
   04925 Aldosterone synthesis and secretion
    706789 (ADCY9)
   04927 Cortisol synthesis and secretion
    706789 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    706789 (ADCY9)
   04270 Vascular smooth muscle contraction
    706789 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    706789 (ADCY9)
   04971 Gastric acid secretion
    706789 (ADCY9)
   04972 Pancreatic secretion
    706789 (ADCY9)
   04976 Bile secretion
    706789 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    706789 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    706789 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    706789 (ADCY9)
   04727 GABAergic synapse
    706789 (ADCY9)
   04725 Cholinergic synapse
    706789 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    706789 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    706789 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    706789 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    706789 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    706789 (ADCY9)
   04714 Thermogenesis
    706789 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    706789 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    706789 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    706789 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    706789 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    706789 (ADCY9)
   05163 Human cytomegalovirus infection
    706789 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    706789 (ADCY9)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     706789 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 DUF512 zf-C2HC_2 DUF2207 Spo7 AC_N
Other DBs
NCBI-GeneID: 706789
NCBI-ProteinID: XP_014980899
Ensembl: ENSMMUG00000039943
LinkDB
Position
20
AA seq 1372 aa
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACRERCFPQTQRRFRYAL
FYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLVVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVLTPVSGRGDSSNLTATAQPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLCLGVAYSVLFETFGYHFRDEACFPSPGAGALHWELLSRALLHGCIHAIGVHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGHSVVADQLKGLKTYLISGQRAKESRCSCAEALLSGFEIIDGSQVS
SGPRGQGTASSGNVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAPQNGCQDEHKN
STKVTSSWLLFLSVPLLAHPPKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGR
WAGVSLDQSALLPLRFKNIREKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELER
SYRTSYQEEVIKNSPVKTFASPTFSSLLDVFLSTIVFLTLSTTCFLKYEAATTPPPPAAL
AVFSAALLLEVLSLAVSIRMVFFLEDVMACTKRLLEWIAGWLPRHCIGAILVSLPALAVY
SHVTSEFETNIHFPVFTGSAALIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCP
DSSVLTSPLDAVQNFSSERNPCNSSVPRDLRRPASLIGQEVVLVFFLLLLLVWFLNREFE
VSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIF
ASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLN
TAQAQDGGHPQEHLQILFEFAKEMMRVVDDFNSNMLWFNFKLRVGFNHGPLTAGVIGTTK
LLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL
YPKCTDHGVFPQHQLSISPDIRVQVDGSIGRSPTDEIANLVPSVQYVDKTSLGSESSTQA
KDAHLSPKRPWKEPVKAEERGRFGRAIEKDDCDETGVEEANELTKLNVSKSV
NT seq 4119 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcatcaccacagcaccgaggtgagttgcgac
tccagcggggacagcaacagcgtgcgcgtcaagatcaaccccaagcagctgtcctccaac
agccatcccaagcactgcaaatacagcatctcctccagctgcagcagctccggggattcc
gggggcgtcccccggcgagtgggcggcggaggccggctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagccgctggtgggaccccaagttcgactcggtgaacctg
gaggaggcctgccgggagcgctgcttcccgcagacccagcgccggttccggtatgcgctc
ttctacatcggcttcgcctgccttctgtggagcatctattttgcggtgcacatgagatcc
agactgatcgtcatggttgcccccgcgctgtgcttcctcgtggtgtgtgtgggcttcttt
ctgtttaccttcaccaagctgtacgcccggcattacgcgtggacctcgctggctctcacc
ctgctggtgttcgccctgaccctggctgcgcagttccaggtcttgacgcctgtctcagga
cgcggcgacagctccaaccttacggccacagcccagcccacagatacttgcttatctcaa
gtggggagcttctccatgtgcatcgaagtgctctttttgctctataccgtcatgcactta
cctttgtacctgagcttgtgtctgggggtggcctactctgtccttttcgagacctttggc
taccatttccgggatgaagcctgcttcccctcgcccggagccggggccctgcactgggag
ctgctgagcagggcgctgcttcacggctgcatccatgccatcggggtccacctgttcatc
atgtcccaggtgaggtccaggagcaccttcctcaaggtagggcaatccattatgcacggg
aaggacctggaagtggaaaaagccctcaaagagaggatgattcattccgtgatgccaaga
atcatagccgatgacttaatgaagcagggggatgaggagagtgagaattctgtcaagagg
catgccacctcgagccccaagaacaggaagaaaaagtcttccatccaaaaagcgcctata
gccttccgccctttcaagatgcagcagatcgaagaagtcagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaacaagtccgcccacgccctggtgggtctcctgaac
gatctgttcggtcgcttcgaccgcctgtgtgaggaaaccaagtgtgagaaaatcagcact
ctgggagactgttactattgcgtggcgggctgtcccgagccccgggccgaccatgcctac
tgctgcatcgagatgggcctgggcatgatcaaggccatcgagcagttctgccaggagaag
aaggagatggtgaacatgcgagtcggggtgcacacgggtaccgtcctgtgtggcatcctg
ggcatgaggaggtttaaatttgatgtgtggtccaacgatgtgaacctggccaatctcatg
gagcagctgggagtggccggcaaagttcacatttctgaggccactgcaaaatacttagat
gaccggtacgaaatggaagacgggaaagttatcgaacggctgggccacagcgtggttgct
gaccagttgaaaggtttgaagacttacctgatatcgggtcagagagccaaggagtctcgc
tgcagctgtgcagaggccttgctttctggctttgagatcattgacggctcacaggtgtcc
tcaggccctaggggacaggggacagcgtcatcagggaatgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccttcatgcggaatcacatttgctcccaaa
tctgaagccggcgccgagggaggagcacctcaaaacggctgccaagacgagcataaaaac
agcaccaaggtaacaagctcatggctgttgttcctgtcagttcctctcctggcgcatcca
cccaaggcttctggaggacctaatcccaaaactcagaacgggcttctgagccctccccaa
gaggagaagctcaccaacagtcagacctctctgtgtgagatcttgcaggagaagggaagg
tgggcaggggtgagcctggaccagtcggctctccttccactgaggttcaagaacatccgg
gagaaaacggacgcccactttgtggacgttatcaaagaagacagcctgatgaaagattat
ttttttaagccgcccattaaccagttcagcctgaacttcctggatcaggagctggagcga
tcctacaggaccagctatcaagaagaggtcataaagaactcccctgtgaagacgtttgct
agtcccaccttcagctccctcctggatgtgtttctgtcgaccatagtgtttctgacgctg
tccaccacctgcttcctgaagtacgaggcggccaccacgcctcccccacccgccgccctg
gctgtcttcagcgcggccctgctgctggaggtgctgtccctcgcagtgtccatcaggatg
gtgttcttcctggaggacgtcatggcctgcaccaagcgcctgctggagtggatcgccggc
tggctaccgcgtcactgcatcggggccatcctggtgtcgcttcctgcactggccgtctac
tcccatgtcacctccgaatttgagacgaacatacacttcccagtgttcacaggctctgcc
gcgctgattgccgtcgtgcactactgtaacttctgccagctcagctcctggatgaggtcc
tctctcgccaccgttgtgggggccgggccgctgctcctgctctacgtctccctgtgccca
gacagttctgtattaacttcgccccttgacgcagtacagaatttcagttccgagaggaac
ccgtgcaatagctcagtgccacgtgacctccggcggccggccagcctcatcggccaggag
gtggttctcgtcttctttctcctgctcttgttggtctggttcctgaatcgcgaattcgaa
gtcagctaccgtctccactaccacggggacgtggaagcggatcttcaccgcaccaagatc
cagagcatgcgggatcaggcggactggctgctgagaaacatcatcccctaccacgtggct
gagcagctgaaggtgtcccagacctactccaagaaccacgacagcggaggggtgatcttc
gccagcatcgtcaacttcagcgagttctacgaggagaactacgagggtggcaaggagtgc
taccgggtcctcaacgagctcatcggggacttcgatgagctcctaagcaagccggactac
agcagcattgagaagatcaagaccatcggagccacgtacatggcggcgtcggggctgaac
accgcacaggcccaggatggcggccacccacaggagcatctgcagatcctgttcgagttc
gccaaggagatgatgcgtgtggtggacgacttcaacagcaacatgctgtggttcaacttc
aagctccgcgtcggcttcaaccacgggcccctcacggccggggtcatcggcaccaccaag
ctgctgtacgacatctggggagacaccgtcaacatcgccagcaggatggacaccaccggc
gtggagtgccgcatccaggtgagcgaagagagctaccgcgtcttgagcaagatgggctac
gacttcgactacagagggaccgtgaacgtcaaggggaaaggccagatgaaaacctacttg
tacccaaagtgcacggaccacggggtcttcccgcagcaccagctgtccatctccccagac
atccgtgtccaggtggatggcagcatcggacggtctcccacagacgagattgccaacctg
gtgccttctgtccagtatgtggacaagacatctctgggttctgagagcagcacgcaggcc
aaggacgcccacctgtcccccaagagaccctggaaagagcccgtcaaagccgaagaaagg
ggtcgatttggcagagccatagagaaagacgactgtgacgaaacaggagtagaagaagcc
aacgaactcaccaagctcaacgtttcaaagagtgtgtga

KEGG   Macaca mulatta (rhesus monkey): 707978
Entry
707978            CDS       T01028                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6 isoform X1
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04727  GABAergic synapse
mcc04742  Taste transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04962  Vasopressin-regulated water reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05032  Morphine addiction
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    707978 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    707978 (ADCY6)
   04371 Apelin signaling pathway
    707978 (ADCY6)
   04072 Phospholipase D signaling pathway
    707978 (ADCY6)
   04024 cAMP signaling pathway
    707978 (ADCY6)
   04022 cGMP-PKG signaling pathway
    707978 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    707978 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    707978 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    707978 (ADCY6)
   04062 Chemokine signaling pathway
    707978 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    707978 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    707978 (ADCY6)
   04912 GnRH signaling pathway
    707978 (ADCY6)
   04913 Ovarian steroidogenesis
    707978 (ADCY6)
   04915 Estrogen signaling pathway
    707978 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    707978 (ADCY6)
   04921 Oxytocin signaling pathway
    707978 (ADCY6)
   04926 Relaxin signaling pathway
    707978 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    707978 (ADCY6)
   04918 Thyroid hormone synthesis
    707978 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    707978 (ADCY6)
   04916 Melanogenesis
    707978 (ADCY6)
   04924 Renin secretion
    707978 (ADCY6)
   04925 Aldosterone synthesis and secretion
    707978 (ADCY6)
   04927 Cortisol synthesis and secretion
    707978 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    707978 (ADCY6)
   04270 Vascular smooth muscle contraction
    707978 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    707978 (ADCY6)
   04971 Gastric acid secretion
    707978 (ADCY6)
   04972 Pancreatic secretion
    707978 (ADCY6)
   04976 Bile secretion
    707978 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    707978 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    707978 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    707978 (ADCY6)
   04727 GABAergic synapse
    707978 (ADCY6)
   04725 Cholinergic synapse
    707978 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    707978 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    707978 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    707978 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    707978 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    707978 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    707978 (ADCY6)
   04714 Thermogenesis
    707978 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    707978 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    707978 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    707978 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    707978 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    707978 (ADCY6)
   05163 Human cytomegalovirus infection
    707978 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    707978 (ADCY6)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     707978 (ADCY6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 DUF2339 HNOBA TBK1_ULD Shisa
Other DBs
NCBI-GeneID: 707978
NCBI-ProteinID: XP_028685276
Ensembl: ENSMMUG00000006253
LinkDB
Position
11
AA seq 1168 aa
MSWFSGLLVPKVDERKTAWGERNGQKRSRRCGTRAGGFCTPRYMSCLRDAEPPSPTPAGP
PRCPWQDDTFIRRGGPGKGKELGLRAVALGFEDTEVTTTVGGTAEVAPDAVPRSGRSCWR
RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPTRPQPAY
VALLACAAALFLGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLW
CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN
VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINT
KKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC
LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV
HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA
YLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
QMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKK
YSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSILMLGIYASIFLLLLVTVLICAVYSC
GSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPMRTCAARMLNLT
PADITACHLQQLNYSLGLDAPLCEGTTPTCSFPEYFIGSVLLSLLASSVFLHISSIGKLA
MVFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPV
ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHF
LARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIIS
EERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNN
FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKG
YQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3507 nt   +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggtccctaaagtggatgaacggaaaacagcctggggt
gaacgcaatgggcagaagcgttcacggcgctgtggcactcgggcaggtggcttctgcacg
ccccgctatatgagctgcctccgggatgcagagccacccagccccacccctgcgggcccc
cctcggtgcccctggcaggatgacaccttcatccggaggggcggcccgggcaagggcaag
gagctggggctgcgggcagtggccctgggcttcgaggacacagaggtgacaacgacagtg
ggcgggacagctgaggtggcgcccgacgcggtgcccaggagtgggcgatcctgctggcgc
cgtctggtgcaggtgttccagtcgaagcagttccgttcggccaagctggagcgcctgtac
cagcggtacttcttccagatgaaccagagcagcctgacgctgctgatggcggtgctggtg
ctgctcacggcggtgctgctggctttccacgcggcgcccacccgccctcagcctgcctat
gtggccctgctggcctgcgccgccgccctgttcctggggctcatggtggtgtgtaaccgg
catagcttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcg
gcagtgcaggtcgggggcgccctcgcagcagacccacgcagcccctctgcgggcctctgg
tgccctgtgttcttcgtctacatcgcctacacgctcctccccatccgcatgcgggctgcg
gtcctcagcggcctgggcctctccaccctgcatttgatcttggcctggcaacttaaccgt
ggtgatgccttcctctggaagcagctcggtgccaatgtgctgctgttcctctgcaccaac
gtcattggcatctgcacacactatccagcagaggtatctcagcgccaggcctttcaggag
acccgcggttacatccaggcccggctccacctgcagcatgagaatcggcagcaggagcgg
ctgctgctgtcggtgttgccccagcatgttgccatggagatgaaagaagacatcaacaca
aaaaaagaagacatgatgttccacaaaatctacatacagaagcatgacaatgtcagcatc
ctgtttgcagacattgagggcttcaccagcctggcatcccagtgcactgcacaggagctg
gtcatgaccctgaatgagctctttgcccggtttgacaagctggctgcggagaatcactgc
ctgaggatcaagatcttgggggactgttactactgtgtgtcagggctgccggaggcccgg
gccgaccatgcccactgctgtgtggagatgggggtagacatgattgaggccatctcgctg
gtacgtgaggtgacaggtgtgaatgtgaacatgcgcgtgggcattcacagtgggcgtgtg
cactgcggcgtccttggcttgcggaaatggcagttcgatgtgtggtccaatgatgtgacc
ctggccaaccacatggaggcaggaggccgggctggccgcatccacatcactcgggcaaca
ctgcagtacctgaatggggactacgaggtggagccgggccgtggtggcgagcgcaacgca
tacctcaaggagcagcacattgagactttcctcatcctgggcgccagccagaaacggaaa
gaggagaaggccatgctggccaagctgcagcggactcgggccaactccatggaagggctg
atgccgcgctgggtgcctgatcgtgccttctcccggaccaaggactccaaggccttccgc
cagatgggcattgatgattccagcaaagacaaccggggcacccaagatgccctgaaccct
gaggatgaggtggatgagttcctgagccgtgccatcgatgcccgcagcattgatcagctg
cggaaggaccatgtgcgccggtttctgctcaccttccagagagaggatcttgagaagaag
tactcccggaaggtggatccccgcttcggagcctacgttgcctgtgccctgttggtcttc
tgcttcatctgcttcatccagcttctcatcttcccacactccatcctgatgcttgggatc
tatgccagcatcttcctgctgctgctggtcaccgtgctgatctgtgccgtgtactcctgt
ggttctctgttccctaaggccctgcaacgtctgtcccgcagcatcgttcgctcacgggca
catagcaccgcagttggcatcttttccgtcctgcttgtctttacttctgccattgccaac
atgttcacctgtaatcacacccctatgcggacctgtgcagcccggatgctgaatttaaca
cctgctgacatcactgcctgccacctgcagcagctcaattactctctgggcctggatgct
cccctgtgtgagggcaccacgcccacctgcagcttccctgagtacttcatcgggagcgtg
ctgctgagtctcttggccagctctgtcttcctgcacatcagcagcatcgggaagttggcc
atggtctttgtcttggggctcatctatttggtgctgcttctgctgggtcccccagccacc
atctttgacaactatgacctactgcttggcgtccatggcttggcttcttccaatgagacc
tttgatgggctggactgtccagctgcagggagggtggccctcaaatatatgacccctgtg
attctgctggtgtttgcgctggcgctgtatctgcatgctcagcaggtggagtcgactgcc
cgcctagacttcctctggaaactacaggcaacaggggagaaggaggagatggaggagcta
caggcatacaaccggaggctgctgcataacattctgcccaaggacgtggccgcccacttc
ctggcccgggagcgccgcaatgatgaactctactatcagtcgtgtgagtgtgtggctgtt
atgtttgcctccattgccaacttctctgagttctatgtggagctggaggcaaacaatgag
ggtgtcgagtgcctgcggctgctcaacgagatcatcgctgactttgatgagatcatcagc
gaggagcggttccggcagctggaaaagatcaagacaattggtagcacctacatggctgcc
tcagggctgaacgccagcacctacgatcaggtgggccgctcccacatcactgccctggct
gactatgccatgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaat
ttccagatgaagattgggctgaacatgggcccagtcgtggcaggtgtcatcggggctcgg
aagccgcagtatgacatctgggggaacacagtgaatgtctctagtcgtatggacagcacg
ggggtccccgaccgaatccaggtgaccacggacctgtaccaggttctagctgccaagggc
taccagctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctac
ttcctcaatgggggccccagcagttag

KEGG   Macaca mulatta (rhesus monkey): 714684
Entry
714684            CDS       T01028                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04727  GABAergic synapse
mcc04742  Taste transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05032  Morphine addiction
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    714684 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    714684 (ADCY4)
   04371 Apelin signaling pathway
    714684 (ADCY4)
   04020 Calcium signaling pathway
    714684 (ADCY4)
   04072 Phospholipase D signaling pathway
    714684 (ADCY4)
   04024 cAMP signaling pathway
    714684 (ADCY4)
   04022 cGMP-PKG signaling pathway
    714684 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    714684 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    714684 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    714684 (ADCY4)
   04062 Chemokine signaling pathway
    714684 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    714684 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    714684 (ADCY4)
   04912 GnRH signaling pathway
    714684 (ADCY4)
   04913 Ovarian steroidogenesis
    714684 (ADCY4)
   04915 Estrogen signaling pathway
    714684 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    714684 (ADCY4)
   04921 Oxytocin signaling pathway
    714684 (ADCY4)
   04926 Relaxin signaling pathway
    714684 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    714684 (ADCY4)
   04918 Thyroid hormone synthesis
    714684 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    714684 (ADCY4)
   04916 Melanogenesis
    714684 (ADCY4)
   04925 Aldosterone synthesis and secretion
    714684 (ADCY4)
   04927 Cortisol synthesis and secretion
    714684 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    714684 (ADCY4)
   04270 Vascular smooth muscle contraction
    714684 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    714684 (ADCY4)
   04971 Gastric acid secretion
    714684 (ADCY4)
   04972 Pancreatic secretion
    714684 (ADCY4)
   04976 Bile secretion
    714684 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    714684 (ADCY4)
   04727 GABAergic synapse
    714684 (ADCY4)
   04725 Cholinergic synapse
    714684 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    714684 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    714684 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    714684 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    714684 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    714684 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    714684 (ADCY4)
   04714 Thermogenesis
    714684 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    714684 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    714684 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    714684 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    714684 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    714684 (ADCY4)
   05163 Human cytomegalovirus infection
    714684 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    714684 (ADCY4)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     714684 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Other DBs
NCBI-GeneID: 714684
NCBI-ProteinID: XP_028707286
Ensembl: ENSMMUG00000020698
LinkDB
Position
7
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLVVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTVYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVDSPVSTSTPLQEKTLASFSPQWSLDRSRTLRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLLLFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTATILLVFAMAITSLFFFPASSDCPFQAPNVSSMISNLSWELPGSLPLISVPY
SMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSDCLIVRLYLGPLDS
RPGVLKEPKFMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRSGPPSVTLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccaccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctgggaatcgtgctctgtgcg
ctcgcggcgctgctcgtggttgcctgggccagcggcagggagctgacctcagacccgagc
ttcctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgcgagcagcgactgcagcgctggacgcgtcctctgtccggcttggtatgggtcgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctattttctcttcgtcatcttcacggtgtatgccatgctgcccttgggcatgcgggac
gccgccgtcgcgggcctcgcctcctcactctcgcatctactggtcctggggctgtatctt
gggccacagccggactcacggcctgcactgctgcctcagttggcagcaaatgcggtgctg
ttcctgtgcgggaacgtggcaggagtgtaccacaaggcgctgatggagcgcgccctgcgg
gccacgttccgggaggcactcagctccttgcactcgcgccggcggctggacaccgaaaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaaa
gcagagatcatggcacggctgcaggcaggacaggggtcacggccagagagcaccaacaat
ttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtatgctgacattgtg
ggcttcacgcggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctccggactgccactctcactgccagaccatgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaactgcgggcagccactggc
gtggacatcaacatgcgtgtgggcgtgcactcaggcagtgtactctgtggagtcatcggg
ctgcagaagtggcagtatgacgtttggtcccatgatgtcacactggctaaccacatggag
gcaggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgctggcagga
gcttatgctgtggaggacgcaggcatggagcatcgggatccctaccttcgggagctaggg
gagcccacctatctggtcatcgatccacgggcagaggaggaggatgagaagggcactgca
ggaggcttgctctcctcgcttgagggccccaagatgcgtccatcactgctgatgacccgt
tacctggagtcctggggtgcagccaagccttttgcccacctgagccacgtagacagccct
gtgtccacctccacccctctccaggagaagaccctggcttccttcagcccccagtggagc
ctagatcggagccgtaccctccgtggactggatgatgaactggacaccggggatgccaag
ttcttccaggtcattgagcagctcaactcacagaaacagtggaagcagtcgaaggacttc
aacccactgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
atccccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctagtgacaaacaggcccccagctctggccatcacgtatagcatcaccttc
ctcctcttcctcctcctcctttttgtctgcttctcagaggacctgatgaggtgtgtcctg
aaaggccccaagatgctgcactggctgcctgcactgtctggcctggtggccacacgacca
ggactgagaatagccttgggcaccgccaccatcctccttgtctttgccatggccattacc
agcctgttcttcttcccagcatcatcagactgccctttccaagctcccaatgtgtcctcc
atgatttccaacctctcctgggagctccctgggtctctgcctctcatcagtgtcccatac
tccatgcactgctgcacgctgggcttcctctcctgctccctctttctgcacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggcagcatcctgctccctcttcctgcac
tcccacgcctggctgtccgactgcctcatcgtccgcctctatctgggccccttggactcc
aggcccggagtgctgaaggagcccaaattcatgggtgctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcgccagaatgagtactactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagcgggaggagacagagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcacacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcctacgaatgcgtttgtgtcctcttcgcttcagtccca
gacttcaaggagttctactctgaatccaacatcaatcatgagggcctagagtgtctgagg
ctgctcaatgaaataattgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaagaccattggcagcacctacatggcagccacaggattaaatgccacc
tctggacaggatgcacaacaggatgctgaacggagctgcagccaccttggcactatggtg
gaatttgccgttgccctggggtctaagctggacgtcatcaacaagcattcattcaacaac
ttccgcctgcgtgtggggttgaaccacggaccagtagtagctggagttattggggcccag
aagccacaatatgacatttggggcaacacagtgaatgtggccagccgcatggagagtaca
ggagtccttggcaaaatccaagtgactgaggagacagcctgggccctacagtccctgggc
tacacctgctacagccggggggtcatcaaggtgaaaggcaaagggcagctctgcacctac
ttcctgaacacagacttgacacgaagtggacctccttcagttaccctaggctga

KEGG   Macaca mulatta (rhesus monkey): 715897
Entry
715897            CDS       T01028                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04727  GABAergic synapse
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05012  Parkinson disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05032  Morphine addiction
mcc05034  Alcoholism
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    715897 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    715897 (ADCY5)
   04371 Apelin signaling pathway
    715897 (ADCY5)
   04072 Phospholipase D signaling pathway
    715897 (ADCY5)
   04024 cAMP signaling pathway
    715897 (ADCY5)
   04022 cGMP-PKG signaling pathway
    715897 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    715897 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    715897 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    715897 (ADCY5)
   04062 Chemokine signaling pathway
    715897 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    715897 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    715897 (ADCY5)
   04912 GnRH signaling pathway
    715897 (ADCY5)
   04913 Ovarian steroidogenesis
    715897 (ADCY5)
   04915 Estrogen signaling pathway
    715897 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    715897 (ADCY5)
   04921 Oxytocin signaling pathway
    715897 (ADCY5)
   04926 Relaxin signaling pathway
    715897 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    715897 (ADCY5)
   04918 Thyroid hormone synthesis
    715897 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    715897 (ADCY5)
   04916 Melanogenesis
    715897 (ADCY5)
   04924 Renin secretion
    715897 (ADCY5)
   04925 Aldosterone synthesis and secretion
    715897 (ADCY5)
   04927 Cortisol synthesis and secretion
    715897 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    715897 (ADCY5)
   04270 Vascular smooth muscle contraction
    715897 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    715897 (ADCY5)
   04971 Gastric acid secretion
    715897 (ADCY5)
   04972 Pancreatic secretion
    715897 (ADCY5)
   04976 Bile secretion
    715897 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    715897 (ADCY5)
   04727 GABAergic synapse
    715897 (ADCY5)
   04725 Cholinergic synapse
    715897 (ADCY5)
   04728 Dopaminergic synapse
    715897 (ADCY5)
   04726 Serotonergic synapse
    715897 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    715897 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    715897 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    715897 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    715897 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    715897 (ADCY5)
   04714 Thermogenesis
    715897 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    715897 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    715897 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    715897 (ADCY5)
   05031 Amphetamine addiction
    715897 (ADCY5)
   05032 Morphine addiction
    715897 (ADCY5)
   05034 Alcoholism
    715897 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    715897 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    715897 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    715897 (ADCY5)
   05163 Human cytomegalovirus infection
    715897 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    715897 (ADCY5)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     715897 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD HILPDA
Other DBs
NCBI-GeneID: 715897
NCBI-ProteinID: XP_014985498
Ensembl: ENSMMUG00000002230
UniProt: A0A1D5QWQ7
LinkDB
Position
2
AA seq 1263 aa
MSSSKSVSPPGYAAQKTAAPAPRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGA
VTPQQQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQ
RRGAAGGGSTRAPPAGGGGGSAAAAASAGGTEVRPRSVEVGLEERRGKGRAADELEAGAV
EGGEESGDGGSSADSGSGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLN
QSSLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILIMAVLCNRAAFHQDHM
GLACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLS
ALHLVIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQAR
LHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGF
TSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCV
EMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAG
GKAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAK
MNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDE
FLGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFV
QITIVPHSVFMLSFYLTCSLLLTLVVFVSVIYSCVKLFPSPLQTLSRKIVRSKMNSTLVG
VFTITLVFLAAFVNMFTCNSKDLLGCLAQEHNISASQVNACHVVESAVNYSLGDEQGFCG
SPWPNCNFPEYFTYSVLLSLLACSVFLQINCIGKLALMLAIELIYVLIVEVPGVTLFDNA
DLLVTANAIDFFNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLW
KLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIA
NFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDS
TYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDI
WGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGP
PLS
NT seq 3792 nt   +upstreamnt  +downstreamnt
atgtccagctccaaaagcgtgagccccccgggctacgcggcgcagaagactgcggcgccg
gcgccccggggaggccccgaacaccgctcggcgtggggcgaggccgattcccgcgcgaat
ggctacccccatgcccccgggggttctgcccgcggctccaccaagaaacccgggggggcg
gtgaccccgcagcagcagcagcagcagcgcctggccagccgctggcgcagcgacgacgac
gacgatcctccgctgagtggcgacgatcccctggccgggggcttcggcttcagcttccgc
tccaagtccgcctggcaggagcgcggcggcgacgactgcggtcgcggcagccgccggcaa
cggcggggcgcggccggcgggggcagcacccgggcgccccctgcgggcggcggcggcggc
tcggcggcggcggctgcctcggcgggcgggacggaggtgcgccctcgctcggtggaggtg
ggcctggaggagcggcggggcaaggggcgcgcggccgacgagctggaggccggcgccgtc
gagggcggcgaggagtccggggatggcggtagttcggcagactcgggctcgggcgcgggg
cccggcgcggtgctgtccctgggcgcctgctgcctggcgttgctgcagatattccgctcc
aagaagttcccgtcggacaaactggagcggctgtaccagcgctacttcttccgcctgaac
cagagcagcctcaccatgctcatggccgtgctggtgctcgtgtgcctggtcatgttggcc
ttccacgcggcgcggcccccgctccagctgccctacctggccgtgctggcggccgccgtg
ggcgtcatcctcatcatggctgtgctctgcaaccgcgccgccttccaccaggaccacatg
ggcctggcctgctatgcgctcatcgccgtggtgctggccgtccaggtggtgggcctgctg
ctgccgcagccgcgcagcgcctctgagggcatctggtggaccgtgttcttcatctacacc
atctacacgctgctgcccgtgcgcatgcgggccgcggtgctcagcggggtgctcctgtcc
gccctccacctggtcatcgccctgcgcaccaacgcccaggaccagttcctgctcaagcag
cttgtctccaatgttctcattttctcctgcaccaacatcgtgggtgtctgcacccactac
ccagctgaggtctcccagagacaggctttccaggagacccgagagtgcatccaggcgcgg
ctccactcacagcgggagaaccagcaacaggagcggctcctgctgtctgtccttccccgt
catgttgccatggagatgaaagcagacatcaacgccaagcaggaggatatgatgttccat
aagatttacatccagaaacatgacaacgtgagcatcctgtttgctgacatcgagggcttc
accagcctggcatcccagtgcaccgcacaggaactggtcatgaccctcaacgagctcttc
gcccgcttcgacaagctggccgcagagaatcactgtttacgtattaagatcctcggggat
tgttattactgcgtctcggggcttcctgaagcaagggctgaccacgcccactgctgcgtg
gagatgggcatggacatgatcgaggccatctcgttggtccgggaggtgacaggggtgaac
gtgaacatgcgtgtgggaattcacagcgggcgagtacactgcggtgtccttggtctaagg
aagtggcagttcgacgtctggtctaacgacgtcacgctagccaaccacatggaggctggc
ggcaaggcgggacgcatccacatcaccaaggctacactcaactacctgaacggggactac
gaggtggagccaggctgtgggggcgagcgcaacgcctacctcaaggagcacagtatcgag
accttcctcatcctgcgctgcacccagaagcggaaagaagagaaggccatgatcgccaag
atgaaccgccagagaaccaactccatcgggcacaacccacctcactggggggctgagcgc
cccttctacaaccacctgggtggcaaccaggtgtccaaggagatgaagcggatgggcttt
gaagaccccaaggacaagaatgcccaggagagtgcaaaccctgaggatgaagtggatgag
tttctgggccgcgccattgacgccaggagcattgacaggcttcggtctgagcacgtccgc
aagttcctcctgaccttcagggagcctgacttagagaagaagtactccaagcaggtagac
gaccgatttggtgcctatgtggcgtgtgcctcgctcgtcttcctcttcatctgctttgtc
cagatcaccatcgtgccccactctgtattcatgctcagcttctacctgacctgttccctg
ctgctgaccttggtggtgtttgtgtctgtgatctactcctgcgtaaagctcttcccctcc
ccgctgcagactctctccaggaagatcgtgcggtccaagatgaacagcaccctggttggg
gtgttcaccatcaccctggtgttcctggcagcttttgtcaacatgttcacatgcaactcc
aaggacctgctgggctgcttggcacaggagcacaacatcagcgcaagccaggtcaacgca
tgtcatgtggtggagtcggccgtcaactacagcctgggcgatgagcagggcttctgtggc
agcccctggcccaactgcaacttccccgagtacttcacctacagcgtgctgctcagcctg
ctggcctgctccgtgttcctgcagatcaactgcatcgggaagctggcgctcatgctggcc
atcgagctcatctacgtgctcatcgtggaggtgccgggtgtcacgctcttcgacaatgcc
gacctgctggtcaccgccaatgccatagacttcttcaacaacgggacctcccagtgccct
gagcacgcaaccaaggtggcattgaaggtggtgacgcccatcatcatctcagtctttgtg
ctggccctgtacctgcacgcccagcaggtggagtccactgcccgcctcgacttcctctgg
aaactgcaggccacagaggagaaggaggagatggaggagctgcaggcctacaaccggcgg
ctgctgcacaacatcctgcccaaggatgtggccgctcacttcctggcccgcgagcggcgc
aacgatgagctctactatcagtcctgtgagtgcgtggcggtcatgttcgcctccatcgcc
aacttctccgaattctacgttgagctggaggccaacaacgagggtgtcgagtgcctgcgg
ctactcaatgagatcatcgctgactttgatgagatcatcagcgaggatcggttccggcag
ctggagaagatcaagaccatcggcagcacctacatggctgcctccggcctcaacgactcc
acctacgacaaggtgggcaagacccacatcaaggcactggccgactttgccatgaagctg
atggaccagatgaagtacatcaatgagcactctttcaacaacttccagatgaagatcggg
ctcaacatcggccccgtggtggccggggtgataggggcacgaaagcctcagtacgacatc
tggggcaataccgtgaacgtggccagccgcatggacagcactggtgtacctgaccgcatc
caggtcaccacggacatgtaccaggtgctggccgccaacacataccaactggagtgccgg
ggcgtggtcaaggtcaagggcaaaggcgagatgatgacctacttcctcaatggagggccc
ccgctcagttag

DBGET integrated database retrieval system