KEGG   Macaca mulatta (rhesus monkey): 693554
Entry
693554            CDS       T01028                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04068  FoxO signaling pathway
mcc04150  mTOR signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04510  Focal adhesion
mcc04650  Natural killer cell mediated cytotoxicity
mcc04720  Long-term potentiation
mcc04722  Neurotrophin signaling pathway
mcc04726  Serotonergic synapse
mcc04730  Long-term depression
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc05010  Alzheimer disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05034  Alcoholism
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05216  Thyroid cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    693554 (BRAF)
   04012 ErbB signaling pathway
    693554 (BRAF)
   04015 Rap1 signaling pathway
    693554 (BRAF)
   04068 FoxO signaling pathway
    693554 (BRAF)
   04024 cAMP signaling pathway
    693554 (BRAF)
   04150 mTOR signaling pathway
    693554 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    693554 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    693554 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    693554 (BRAF)
   04062 Chemokine signaling pathway
    693554 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    693554 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    693554 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    693554 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    693554 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    693554 (BRAF)
   04720 Long-term potentiation
    693554 (BRAF)
   04730 Long-term depression
    693554 (BRAF)
   04722 Neurotrophin signaling pathway
    693554 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    693554 (BRAF)
   05205 Proteoglycans in cancer
    693554 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    693554 (BRAF)
   05212 Pancreatic cancer
    693554 (BRAF)
   05225 Hepatocellular carcinoma
    693554 (BRAF)
   05226 Gastric cancer
    693554 (BRAF)
   05214 Glioma
    693554 (BRAF)
   05216 Thyroid cancer
    693554 (BRAF)
   05221 Acute myeloid leukemia
    693554 (BRAF)
   05220 Chronic myeloid leukemia
    693554 (BRAF)
   05218 Melanoma
    693554 (BRAF)
   05211 Renal cell carcinoma
    693554 (BRAF)
   05219 Bladder cancer
    693554 (BRAF)
   05215 Prostate cancer
    693554 (BRAF)
   05213 Endometrial cancer
    693554 (BRAF)
   05224 Breast cancer
    693554 (BRAF)
   05223 Non-small cell lung cancer
    693554 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    693554 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    693554 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    693554 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    693554 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    693554 (BRAF)
   05160 Hepatitis C
    693554 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    693554 (BRAF)
   01522 Endocrine resistance
    693554 (BRAF)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     693554 (BRAF)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   693554 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 693554
NCBI-ProteinID: XP_014990564
Ensembl: ENSMMUG00000042793
UniProt: A0A1D5Q9W4
LinkDB
Position
3
AA seq 763 aa
MAALSGGGGGGAEPGQALFNGDMEPEAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEAL
LDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLEYLGNGTDFSVSSSASMDTVTSSS
SSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKA
LMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFT
LAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEE
ASLAETALTSGSSPSAPTSDSLGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSS
SAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQR
ERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKM
LNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHII
ETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRW
SGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQ
IIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKI
HRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2292 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggtggcggtggtggcggcgcggagccgggccaggctctgttcaac
ggggacatggagcccgaggccggcgccgcggcctcttcggctgcggaccctgccattccg
gaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagaggcccta
ttggacaaatttggtggggagcataatccaccatcaatatatctggaggcctatgaagaa
tacaccagcaagctagatgcactccaacaaagagaacaacagttattggaatatctgggg
aacggaactgatttttctgtttctagctctgcatcaatggacaccgttacatcttcttcc
tcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccacagatgtg
tcacggagcaaccccaagtcaccacaaaaacctatcgttagagtcttcctacccaacaaa
cagaggacagtggtacctgcaaggtgtggagttacagtccgagacagtctaaagaaagca
ctgatgatgagaggtctaatcccagaatgctgtgctgtttacagaattcaggatggagag
aagaaaccaattggctgggacactgatatttcctggcttactggagaagaattgcatgtg
gaagtgttggagaatgttccacttacaacacacaactttgtacgaaaaacatttttcacc
ttagcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaaacatgt
ggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaattatgac
caacttgatttgctgtttgtctccaagttctttgaacaccacccaataccacaggaagag
gcctccttagcagagactgccctaacatctggatcatccccttccgcacccacctcagac
tctcttgggccccaaattctcaccagtccgtctccttcaaaatccattccaattccacag
cccttccgaccagcagatgaagatcatcgaaatcaatttgggcaacgagaccggtcctca
tcagctcccaatgtgcacataaacacaatagaacctgtcaatattgatgacttgattaga
gaccaaggatttcgtggtgatggaggatcaaccacaggtttgtctgccaccccccctgcc
tcattacctggctcactcactaacgtgaaagccttacagaaatctccaggacctcagcga
gaaaggaagtcatcttcatcctcagaagacaggaatcgaatgaaaacacttggtagacgg
gactcgagtgatgactgggagattcctgatgggcagattacagtgggacaaagaattgga
tctggttcatttggaacagtctacaagggaaagtggcatggtgatgtggcagtgaaaatg
ttgaatgtgacagcacctacacctcagcagttacaagccttcaaaaatgaagtaggagta
ctcaggaaaacacgacacgtgaatatcctactcttcatgggctattccacaaagccacaa
ctggctattgttacccagtggtgcgagggctccagcttgtatcaccatctccatatcatt
gagaccaaatttgagatgatcaaacttatagatattgcacgacagactgcacagggcatg
gattacttacacgccaagtcaatcatccacagagacctcaagagtaataatatatttctt
catgaagacctcacagtaaaaataggtgattttggtctagctacagtgaaatctcgatgg
agtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcaccagaagtc
atcagaatgcaagataaaaatccatacagctttcagtcagatgtatatgcatttgggatt
gttctgtatgaattgatgactggacagttaccttattcaaatatcaataacagggaccag
ataatttttatggtgggacgaggatacctatctccagatctcagtaaggtacggagtaac
tgtccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagatgaaaga
ccactctttccccaaattctcgcctctattgagctgctggcccgctcattgccaaaaatt
caccgcagtgcatcagaaccctccttgaatcgggctggtttccaaacagaggattttagt
ctatatgcttgtgcttctccaaaaacacccatccaggcagggggatatggagaatttgca
gccttcaagtag

DBGET integrated database retrieval system