KEGG   Macaca mulatta (rhesus monkey): 693560
Entry
693560            CDS       T01028                                 

Gene name
AFDN
Definition
(RefSeq) afadin isoform X1
  KO
K05702  afadin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04520  Adherens junction
mcc04530  Tight junction
mcc04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    693560 (AFDN)
   04015 Rap1 signaling pathway
    693560 (AFDN)
   04024 cAMP signaling pathway
    693560 (AFDN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    693560 (AFDN)
   04530 Tight junction
    693560 (AFDN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    693560 (AFDN)
SSDB
Motif
Pfam: RA DIL PDZ PDZ_6 FHA PDZ_2 Yop-YscD_cpl
Other DBs
NCBI-GeneID: 693560
NCBI-ProteinID: XP_014993180
Ensembl: ENSMMUG00000021044
LinkDB
Position
4
AA seq 1921 aa
MSAGGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCI
RVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERRLDIDEKPLVVQLNWNK
DDREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQ
ASDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRS
SDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIAR
VMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDHIPKKTKKHL
EGKTPKGKERADGSGYGSALPPEKLPYLVELSPGRRNHFAYYNYHTYEDGSDSRDKPKLY
RLQLSVTEVGTEKLDDSSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMDAETYVEGQRISE
TTMLQSGMKVQFGASHVFKFVDPTQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGD
IHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQDASGPEL
ILPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSNQYRPDISPTER
THKVIAVVNKMVSMMEGVIQEVDQVDQKQKNIAGALAFWMANASELLNFIKQDRDLSRIT
LDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAMSL
LRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEK
QGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEP
FIPTDLIENVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGL
QEFLDPLCQRGFCRLIPHTRSPGTWTIYFEGADYESHLLRENTELAQPLRKEPEIITVTL
KKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQE
RAAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGFELY
NNSAQNGSPESPQLPWAEYSEPKKLPGDDRLTKNRADHRSSPNVANQPPSPGGKSAYASG
TAAKITSVSTGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPPQNQWPNY
EEKPHMHTDSNHSSIAIQRVTRSQEELREDKAYQLERHRIEAAMDRKSDSDMWINQSSSL
DSSTSSQEHLNHSSKSVTPASTLTKSGPGRWKTPAAIPATPVAVSQPIRTDLPPPPPPPP
VHYAGDFDGMSMDLPLPPPPSTNQIGLPSAQVAAAERKKREEHQRWYEKEKARLEEERER
KRREQERKLGQMRTQSLNPAPFSPLTTQQMKPEKPSTLQRPQETVIRELQPQQQPRTIER
RDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAE
ESDRLRKLMLEWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAERRARQTAMPAIS
VLDLLQDEERRRQQQLEEMRKREAEDRARQEEERRRQEEERTKRDAEEKRRQEEGYYSRL
EAERRRQHDEAARRLLEPEAPGLCRPPLPRDYEPPSPSPAPGAPPPPPQRNASYLKTQVL
SPDSLFTAKFVAYNEEEEEEDCSLAGQDKYSSTRMSHGDLLPAPLKPRPPPCQPRPASDG
IFLSNSFQPSPAKANSTAHKKGQPPPPPKKSSSYHPSHCKGRGPNSYPGSAGAAVGAHDA
YRDAKEKRSKSQDADLPGSSGAPENLTFKERQRLFSQGQDVSNKVKASRKLTELENELNT
K
NT seq 5766 nt   +upstreamnt  +downstreamnt
atgtcggcgggcggccgtgacgaggagcggcggaagctggccgacatcatccaccactgg
aacgccaaccggctggacctgttcgagatcagccagcccaccgaggatttggagttccat
ggagtcatgagattttattttcaagataaagctgctggaaactttgcaacaaaatgtatt
cgggtctctagtactgccaccactcaagatgtaatcgaaacgctcgcagagaaatttcga
cctgatatgcgaatgctgtcctctcccaagtattcactctatgaagtgcatgtcagcgga
gaagaaagaagattggacatagatgagaaacctctagttgtacaattgaattggaacaaa
gatgaccgggaaggcagatttgttcttaagaatgagaatgacgccattcctcctaagaag
gctcaaagtaatggacctgaaaagcaggaaaaagaaggcgttatccagaacttcaagaga
actctgtcaaagaaagaaaagaaggaaaaaaagaagagagaaaaagaggcattgcgacag
gcgtctgataaagatgatagacctttccaaggggaggacgttgaaaattctcgactggct
gctgaggtttacaaagacatgcctgaaaccagctttactcgaaccatttctaatcctgag
gtggttatgaaacgacggaggcaacaaaaattggaaaagagaatgcaggaatttcggagc
tcagatgggcggcctgattcaggtggaacattgagaatttatgcagatagtttaaaacca
aatattccctacaagacaatcctgctgtctactacagatcctgcagactttgctgtggct
gaagctttagagaagtatggtctggaaaaagaaaaccctaaggattactgcatcgcccgg
gttatgcttcctcctggagcccagcattctgatgaaaagggtgctaaagaaatcattctt
gatgatgatgagtgtcctttacaaatcttcagggaatggccaagtgacaaagggatttta
gtctttcagttgaagaggaggccaccagaccacatcccaaagaaaaccaagaaacacttg
gaaggcaagacacccaagggaaaggagagagctgacgggtctggctatggctccgccctt
cctccggagaagctgccctatttagtagagttaagcccagggagaaggaatcactttgcc
tactacaactatcacacttatgaagatggttctgactctagagataagccaaagctttac
cgccttcagttaagtgttactgaagttggtacagaaaaattggatgacagctctatccag
ttgtttggcccaggaattcagccccatcactgtgacctcaccaacatggatggagtggtc
actgtgacgcccagaagtatggacgcagaaacctatgtggaaggccagcgtatctcggaa
accaccatgctgcagagtggcatgaaagtgcagtttggggcatcccatgtatttaagttt
gtggaccccactcaggatcatgctcttgcaaaaagatctgtggatggaggcctgatggtt
aagggcccgagacataaacctggaattgttcaggagacaacttttgatttgggaggagat
attcatagtgggacagcattaccgacaagcaagagcaccactaggctggacagcgacaga
gtatcatctgcctctagcacagctgagcggggaatggtgaagccgatgatcagagtagag
cagcagccagattatcgcaggcaagaaagcagaacacaggatgcttctgggcctgaactg
atactgcctgcaagcattgaattcagggaaagttctgaagattcatttttatctgccatt
ataaattatactaatagctctacagtccactttaagttgtcccctacatatgtattatat
atggcatgccggtatgtattgtccaaccagtacagacctgacatcagccctacagagcgc
acgcataaagtcattgcagtcgtcaacaagatggtgagcatgatggagggcgtcatccag
gaagtagaccaggttgaccagaaacagaagaatattgcaggggcacttgccttctggatg
gcaaatgcatctgaacttctcaacttcattaagcaagaccgagaccttagtcggatcaca
ctggatgctcaagatgttttagcacatttggttcaaatggcatttaagtacttggttcac
tgccttcagtcagaacttaataattacatgccagcctttctagatgaccctgaagagaac
agtctgcaaagaccaaaaatagatgatgtgctgcacacgctcacaggagccatgtccttg
ctacgacgctgcagagtcaatgctgccctgaccatccagctcttctcgcagcttttccac
tttatcaatatgtggctgttcaatagattagtgactgacccagattcagggctgtgctcc
cattactggggcgcaattatccgtcagcagctgggccatattgaagcctgggctgagaag
caggggctggagctggctgcagactgtcatctgagcaggatcgtgcaggcaacaactttg
cttaccatggataagtatgcacctgatgacattccaaatataaacagcacctgctttaag
ttaaattcactacaacttcaagccttattacagaactatcactgtgcacctgatgagcct
tttatcccaacggatcttatagaaaatgtagtggctgtggctgaaaacactgcggatgag
ctggcccgcagcgacggaagggaagtgcagttggaggaggatcctgacctgcagctgccg
tttcttttgccagaagatggttattcttgtgatgttgtcagaaacattccaaatggttta
caagaatttttagaccctctgtgccagagaggattttgcaggttaattcctcacacacgt
tcaccaggtacttggacaatatattttgaaggtgcagattatgaaagtcaccttctgcgt
gagaacacagagctggctcagcctctgaggaaagaacctgaaataatcactgtgacccta
aaaaagcagaatggaatgggccttagcattgttgcagcaaagggtgctggtcaagataaa
ctaggaatctatgtgaagtcggttgtgaaaggaggtgctgcagatgtggatggacgtcta
gctgcaggtgatcaactcctcagcgtggatggacgaagtctggttggactctctcaggaa
agggcagcagaactcatgacaagaacaagctctgtggtgacactggaagtagcaaagcag
ggtgccatctaccacggtctggccacccttctcaatcagccatcccccatgatgcagaga
atttcagatcgtcgtggctcaggcaaaccccgaccaaagagtgaaggctttgaactctat
aataattccgctcaaaatgggtctcctgagagtcctcagctgccttgggcagaatatagt
gaaccaaagaaattgcccggtgatgacagactgacgaaaaatagagctgatcaccgttcc
agccccaacgtagcaaatcagcctcctagtcctggagggaaaagtgcatatgcctctgga
acagcagcgaagataacatctgtctctactggaaacctctgcactgaggagcagacgcct
ccgcctagacctgaagcctaccccatccccactcagacgtacaccagagagtattttacc
ttcccagcttccaaatcccaggatcggatggctcctcctcagaaccagtggccaaattat
gaggaaaagccacatatgcacacagatagtaatcactccagtattgcaattcagcgtgtt
acacgttcccaagaagaacttcgagaagataaagcttaccaacttgagcggcatcgaata
gaggcagctatggacagaaagtctgatagtgatatgtggataaatcagagctcctcattg
gactccagtacatctagccaagagcacctgaaccattcctctaagtcggtcacccctgct
tccacactgaccaaaagtggccctggccgttggaaaacaccagcagcaataccggccacc
cctgtggccgtctcccagccaatccgaacagacctgcctccgccacccccgccacctccc
gtccactacgccggtgatttcgatggaatgtccatggatttgcctctcccaccaccccct
tccaccaaccagataggactaccctctgcgcaggtggctgctgccgaacggaaaaagaga
gaggaacatcagcgttggtatgagaaggagaaggcccgcctggaggaggagcgggagagg
aagcggagagagcaggagaggaagttgggccagatgcgcactcagtccctaaaccctgct
ccgttttctcccctgaccacacagcagatgaagcccgaaaagccttccacactccagcgg
ccccaggaaacagtcattcgggagctacagcctcagcagcagccccgcacgatcgagcgc
agggacttgcagtacatcacagtcagcaaagaggagctttcctcgggggacagtctgtct
cctgacccatggaagcgggatgccaaggagaagctggagaagcagcagcagatgcacatc
gtggacatgctgagcaaggagatccaggagctccagagcaaaccggaccgcagcgccgag
gagagcgaccggctgcgcaagctcatgctggagtggcagttccagaagagactacaggag
tcgaagcagaaggacgaagatgacgaggaggaggaggacgacgatgtggacaccatgctc
atcatgcagcgcctggaggctgaacgaagagcgaggcagactgctatgccagcaatctct
gttctagatttgttgcaggacgaggagcggaggcggcagcagcagttagaagagatgcgc
aagcgggaagcggaagaccgagcgaggcaagaggaagagcgccggcggcaggaggaggag
cgaacaaaacgagacgctgaagaaaagaggcgacaggaagaagggtattacagccgcctg
gaagctgagaggcgcagacagcacgacgaggcggcgcgcaggttgctggagcccgaggca
cctggtctgtgccgccctccgcttccgcgggactacgagcccccgtccccgtcccccgcg
cccggcgcccctcctcccccgcctcagcgaaacgcctcctacctcaaaacccaggtcctc
tcccccgactcgctgttcactgccaagtttgttgcatacaatgaggaggaggaggaggag
gactgcagcctagcaggtcaggataagtactccagcacgagaatgtctcatggggacctt
cttcctgcccctcttaaaccacggccacccccctgccagccacgcccggcctccgatggc
atctttctctcgaactcattccagccatccccagccaaagccaacagtactgctcacaaa
aaaggccagcccccgccccctccaaaaaaatccagctcctaccatcccagccactgcaaa
ggtagaggaccaaactcttacccaggatctgccggagcagctgttggagcccatgacgct
taccgggatgcgaaagagaagcgttctaaaagccaagatgcagatttacctggaagttct
ggggcccctgaaaacttgacattcaaggaacgccagcgtcttttttcacaaggtcaagat
gtatccaataaagtgaaagcctctcgtaaattaacagaactggagaatgaactgaacaca
aaatga

DBGET integrated database retrieval system